⨯

working

Sign up to access

Get access to our full offering from over 30 providers

Get access to our full offering from over 30 providers


Get Started
Already a member? Log in here

More Content

More Content

LIBERUM: Alpha Group International: Underlying strength

Companies: Alpha Group International PLC

Most popular equity research this week | 1 - 11 Jan

Companies: SLPUBISMPACNXTALTKWSFDEVALPHCDMGMDGLESPEGFINGTLYBURATVI0IFX0QYP0LCX

LIBERUM: Alpha Group International: A winning business at a cheap valuation

Companies: Alpha Group International PLC

Most popular equity research this week | 9 - 13 July

Companies: APCBMSCRPRPCFSNXMEGPTCNRUAHATDMTRCOSXPFALPHEUSPGETBFDMTLYW7LECSCGYGPMIBUR

LIBERUM: Alpha Group International: Strong H1 trading update

Companies: Alpha Group International PLC

Copyright © 2023 Research Tree | All Rights Reserved. | Terms of Service and Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top