⨯

working

Sign in

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account


Sign In
Not a commercial user? Register here for our wider research bundle

More Content

More Content

Trinity Delta Lighthouse: MaxCyte

Companies: CRSP VRTX VRTX CRSP MXCT MXCS

Most popular equity research this week | 16 - 20 Oct

Companies: WJASEEPLI600258FARNCSRTAMSMEGPSYMDPHLGTEKFANCRRGDIMMAGYTSTLCTHBOTBDOTDBVXPSCLPABCFULDNLVLGHZDVECMTPHSHOECAKEC4XDSCSIDPRBGFISHHOTCJOULHCMVERMXCT

MaxCyte: Strategic investments to support partners & future growth

Companies: MaxCyte, Inc. (MXCT:NAS)MaxCyte, Inc. (MXCT:LON)

Maxcyte revenues rise 21%, hailing three new strategic licences with cell therapy developers

Companies: MaxCyte, Inc.

Trinity Delta Lighthouse: MaxCyte

Companies: MaxCyte, Inc. (MXCT:OTC)MaxCyte, Inc. (MXCT:LON)

Copyright © 2023 Research Tree | All Rights Reserved. | Terms of Service and Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top