⨯

working

Sign up to access

Get access to our full offering from over 30 providers

Get access to our full offering from over 30 providers


Get Started
Already a member? Log in here

More Content

More Content

LIBERUM: Hotel Chocolat* - Outstanding trading over peak

Companies: Hotel Chocolat Group Plc

Most popular equity research this week | 16 - 20 Oct

Companies: WJASEEPLI600258FARNCSRTAMSMEGPSYMDPHLGTEKFANCRRGDIMMAGYTSTLCTHBOTBDOTDBVXPSCLPABCFULDNLVLGHZDVECMTPHSHOECAKEC4XDSCSIDPRBGFISHHOTCJOULHCMVERMXCT

LIBERUM: Hotel Chocolat* - One step back to move three steps forward

Companies: Hotel Chocolat Group Plc

The Small Cap Veteran – 23 Feb 2021

Companies: FIFPFDCBOXHOTC

LIBERUM: Hotel Chocolat* - Huge H1 beat leaves FY numbers eminently beatable

Companies: Hotel Chocolat Group Plc

Copyright © 2023 Research Tree | All Rights Reserved. | Terms of Service and Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top