Research Tree Research Tree Logo

  • Try our Investor Tool
  • Login
  • Sign Up

Research Tree Logo

  • Login
  • Sign Up
  • Features
  • Pricing
  • Reg.News
  • Contact
  • Try our Investor Tool
  • Login
  • Sign Up
  • Providers
  • Companies
⨯
LIVE

Event in Progress:

Join Here ×
  • Providers
  • Companies
⨯
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest
  • Contact
Companies >
USA >
Pharmaceuticals >
Midatech Pharma Plc Sponsored ADR >
Research >
Midatech Pharma - Interim DIPG data to be presented at ISPNO

working
  • 13 Jun 2022

Midatech Pharma - Interim DIPG data to be presented at ISPNO


Midatech Pharma Plc Sponsored ADR (MTP:NAS) | 0 0 0.0%


  • Edison
    • Jyoti Prakash

    • 2 pages


 

Midatech will be presenting interim data from its ongoing Phase I trial assessing lead asset MTX110 in diffuse intrinsic pontine glioma (DIPG) at the upcoming International Symposium on Pediatric Neuro-Oncology (ISPNO). The study is being conducted at the Columbia University Medical Center (CUMC) and the presentation will discuss preliminary results (safety signals) for seven of the 10 study participants. A highlight of this study is the use of an implantable continuous flow device to deliver MTX110 directly to the tumour (bypassing the blood-brain barrier), avoiding the need for new surgical insertions at each treatment cycle. The same device will be used in the company’s upcoming (H222) Phase I study in recurrent glioblastoma (rGBM). As a reminder, MTX110 holds orphan drug and fast track designations in the US for DIPG and GBM, respectively.

Sign up for free to access

Get access to the latest equity research in real-time from 12 commissioned providers.

Get access to the latest equity research in real-time from 12 commissioned providers.


Get Started
Already a member? Log in here
See all the research we have on this company.

Midatech Pharma - Interim DIPG data to be presented at ISPNO


Midatech Pharma Plc Sponsored ADR (MTP:NAS) | 0 0 0.0%


  • Published: 13 Jun 2022
  • Author: Jyoti Prakash
  • Pages: 2
  • Edison


Midatech will be presenting interim data from its ongoing Phase I trial assessing lead asset MTX110 in diffuse intrinsic pontine glioma (DIPG) at the upcoming International Symposium on Pediatric Neuro-Oncology (ISPNO). The study is being conducted at the Columbia University Medical Center (CUMC) and the presentation will discuss preliminary results (safety signals) for seven of the 10 study participants. A highlight of this study is the use of an implantable continuous flow device to deliver MTX110 directly to the tumour (bypassing the blood-brain barrier), avoiding the need for new surgical insertions at each treatment cycle. The same device will be used in the company’s upcoming (H222) Phase I study in recurrent glioblastoma (rGBM). As a reminder, MTX110 holds orphan drug and fast track designations in the US for DIPG and GBM, respectively.

More Content

More Content

Midatech Pharma - Urgent pivot required following Bioasis deal fallout

Companies: Midatech Pharma Plc Sponsored ADR

Edison

Midatech Pharma: Edison Open House Healthcare 2022

Companies: Midatech Pharma Plc

Edison

Midatech Pharma - Planned dose-escalation commences in rGBM study

Companies: Midatech Pharma Plc Sponsored ADR

Edison

Most popular equity research this week | 16 - 20 Oct

Companies: WJASEEPLI600258FARNCSRTAMSMEGPSYMDPHLGTEKFANCRRGDIMMAGYTSTLCTHBOTBDOTDBVXPSCLPABCFULDNLVLGHZDVECMTPHSHOECAKEC4XDSCSIDPRBGFISHHOTCJOULHCMVERMXCT

Research Tree

Midatech Pharma - Announced acquisition to expand portfolio

Companies: Midatech Pharma Plc Sponsored ADR

Edison

Useful Links

  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub

Account

  • Login
  • Free Trial - Join Now
  • Contact
Follow us on Linkedin Follow us on Twitter

Share:

Copyright © 2023 Research Tree | All Rights Reserved. | Terms of Service and Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Blogs
    • Academy
    • Insights
    • News
    • Research Tree
    • The Naked Fund Manager
  • Ideas & Picks
    • Ideas Hub
    • Stock Pick League
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Utilities
    • AIC Sectors
      • Asia Pacific
      • Asia Pacific Equity Income
      • Asia Pacific Smaller Companies
      • Biotechnology & Healthcare
      • China / Greater China
      • Commodities & Natural Resources
      • Country Specialist
      • Debt - Direct Lending
      • Debt - Loans & Bonds
      • Debt - Structured Finance
      • Environmental
      • Europe
      • European Smaller Companies
      • Farmland & Forestry
      • Financials
      • Flexible Investment
      • Global
      • Global Emerging Markets
      • Global Equity Income
      • Global Smaller Companies
      • Growth Capital
      • Hedge Funds
      • India
      • Infrastructure
      • Infrastructure Securities
      • Insurance & Reinsurance Strategies
      • Japan
      • Japanese Smaller Companies
      • Latin America
      • Leasing
      • Liquidity Funds
      • North America
      • North American Smaller Companies
      • Private Equity
      • Property - Debt
      • Property - Europe
      • Property - Rest of World
      • Property - UK Commercial
      • Property - UK Logistics
      • Property - UK Residential
      • Property Securities
      • Renewable Energy Infrastructure
      • Technology & Media
      • UK All Companies
      • UK Equity & Bond Income
      • UK Equity Income
      • UK Smaller Companies
      • VCT AIM Quoted
      • VCT Generalist
      • VCT Generalist Pre Qualifying
      • VCT Specialist: Environmental
      • VCT Specialist: Environmental Pre Qualifying
      • VCT Specialist: Healthcare & Biotechnology
    • Trust Managers
      • 3i Group
      • 3i Investments
      • Aberforth Partners
      • abrdn
      • AEW UK Investment Management
      • Albion Capital
      • Allianz Global Investors
      • Alpha Real Capital
      • Amati Global Investors
      • Amedeo Air Four Plus
      • Apax Guernsey Managers
      • Aquila Capital Investment
      • Artemis Investment Management
      • Asset Value Investors
      • Athelney Trust
      • Atrato Partners Limited
      • Augmentum Capital
      • Axiom Alternative Investments
      • Baillie Gifford
      • Baker Steel Capital
      • Beringea
      • BlackRock Investment Management (UK)
      • Boussard & Gavaudan Asset Management
      • Brevan Howard Capital Management
      • Chelverton Asset Management
      • Columbia Threadneedle
      • CVC Credit Partners
      • Doric Partners
      • Ecofin
      • Fidelity
      • Foresight Group
      • Frostrow Capital
      • Fundsmith
      • Gravis Capital Management
      • Greencoat Capital
      • Gresham House
      • Hansa Capital Partners
      • Harwood Capital
      • ICM
      • InfraRed Capital Partners
      • Invesco Asset Management
      • J.P. Morgan Asset Management
      • Janus Henderson Investors
      • Jupiter Unit Trust Managers
      • KKV Investment Management
      • Liontrust Asset Management
      • Markel CATCo Investment Management
      • Maven Capital Partners
      • MD Barnard and Co
      • Mercia Asset Management
      • Montanaro Investment Managers
      • Neuberger Berman Europe
      • New City Investment Managers
      • Octopus Investments
      • Pantheon Ventures
      • Phoenix Asset Management
      • Polar Capital Holdings
      • Premier Miton
      • Puma Investments
      • Quaero Capital
      • Rampart Capital
      • Ravenscroft
      • Riverstone International
      • Schroder Investment Management
      • Schroder Real Estate Management
      • Seneca Investment Managers
      • Triple Point Investment Management
      • Tritax Management
      • Troy Asset Management
      • TwentyFour Asset Management
      • White Oak Capital Partners
      • Willis Towers Watson
      • YFM Private Equity
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Align Research
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Edison
      • Equity Development
      • eResearch
      • Fidante Partners
      • Five Minute Pitch TV
      • goetzpartners securities Limited
      • Hardman & Co
      • Inbound Capital
      • Independent Investment Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Magnitogorsk Iron and steel works
      • Mello Events
      • Mining Network
      • piworld.co.uk
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS - Research as a Service
      • Radnor Capital Partners
      • Research Tree
      • SEAL Advisors Ltd
      • ShareSoc
      • The AIC
      • Trinity Delta
      • UK Investor Group
      • Yellowstone Advisory
    • High Net Worth Offering
      • Fox-Davies Capital
      • Allenby Capital
      • AlphaValue
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cenkos Securities
      • Couloir Capital
      • Dowgate Capital
      • finnCap
      • First Berlin
      • First Sentinel
      • Hannam & Partners
      • Hybridan
      • Kemeny Capital
      • Liberum
      • Longspur Research
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • The Life Sciences Division
      • VSA Capital
      • WHIreland
      • Whitman Howard
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • Fox-Davies Capital
      • Align Research
      • Allenby Capital
      • AlphaValue
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Atrium Research
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane
      • BNP Paribas Exane - Sponsored Research
      • BRR Media
      • Bryan, Garnier & Co
      • Calderwood Capital
      • Calvine Partners
      • Canaccord Genuity
      • Capital Access Group
      • Cenkos Securities
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Dowgate Capital
      • Edison
      • Equity Development
      • eResearch
      • Fidante Partners
      • finnCap
      • First Berlin
      • First Sentinel
      • Five Minute Pitch TV
      • goetzpartners securities Limited
      • Hannam & Partners
      • Hardman & Co
      • Hybridan
      • Hypothesis Research
      • Inbound Capital
      • Independent Investment Research
      • InterAxS Global
      • Kemeny Capital
      • Kepler | Absolute Hedge
      • Kepler | Trust Intelligence
      • Liberum
      • London Stock Exchange
      • Longspur Research
      • Magnitogorsk Iron and steel works
      • Mello Events
      • Mining Network
      • Northland Capital Partners
      • Numis
      • Panmure Gordon
      • Peel Hunt
      • piworld.co.uk
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS - Research as a Service
      • Radnor Capital Partners
      • Research Tree
      • SEAL Advisors Ltd
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • SI Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • The AIC
      • The Life Sciences Division
      • Trinity Delta
      • UK Investor Group
      • Velocity Trade
      • VSA Capital
      • WHIreland
      • Whitman Howard
      • Winterflood Securities
      • Yellowstone Advisory
      • Zeus Capital
    • Video/Audio Interviews
      • BRR Media
      • Capital Access Group
      • Couloir Capital
      • Edison
      • Equity Development
      • Five Minute Pitch TV
      • Mining Network
      • piworld.co.uk
      • Proactive
      • QuotedData
      • RaaS - Research as a Service
      • Research Tree
      • UK Investor Group
      • Yellowstone Advisory
    • Event Providers
      • Capital Access Group
      • Cenkos Securities
      • Couloir Capital
      • Edison
      • Equity Development
      • Hardman & Co
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Mello Events
      • piworld.co.uk
      • Proactive
      • QuotedData
      • Research Tree
      • ShareSoc
      • Shore Capital
      • The AIC
      • UK Investor Group
      • VSA Capital
      • Yellowstone Advisory
  • Contact
  • Sign Up
  • Sign In