• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×
  • CMS:
  • Edit
  • Stop Editing
  • Publish

  • 28 Jan 26

Cavendish Tech Demo for Skillcast: Skillcast Portal

Cavendish Tech Demo for Skillcast: Skillcast Portal


Skillcast Group Plc | SKL | 42.0 0 0%
Follow Company Follow Company

  • Cavendish
    • 227 views

 
Sorry you are not able to access this content from your country of domicile.

Sign up to access

Get access to our full offering from over 30 providers

Get access to our full offering from over 30 providers


Get Started
Already a member? Log in here

Vox Markets Weekly Wrap

Companies: SKLCTLSDGELCOIGPGBGTTGTATETEPORRTRCSASAIEYESHOEPXENW7LRBWAOMDCCPALMMPALPOLBATG

Vox Markets

Chart Rundown: October 4th

Companies: SAASCTLFTCIQEECOBOXBSWCMNTLENETPALMSCGLICFGESTTGA

Vox Markets

2 P's on a Pod: M&A Themes, Software Winners & Retail Reality

Companies: SKLSDGELCOIGPGBGTTGTATETEPSYNTTRCSASAICWREYESHOEW7LEVOKAOMDCCATG

Vox Markets

Vox Markets Weekly Wrap

Companies: NETPGHHTGRNWHMSITTGTEPAVGSAAIGGCKTSQZAVAPCPIRSTVSVSALFASPRFNTLKDNCNIOXBRCKCARDMAB1CERGWMOSRADMEXBIGBOKU1947

Vox Markets

VSA Capital Tech & Transitional Energy 230125

Companies: SKLNETJDGJNEOLUCE

VSA Capital

2 P's on a Pod: Small Cap Investing with Paul Hill & Paul Scott

Companies: PGHMSITTGSAAIGGBGOCKTAVAPCPIVSVSSPRBBSNNIOXCARDSAGAMEX

Vox Markets
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
  • AI.txt
  • LLMs.txt
  • LLMs Full.txt
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2026

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top