• 30 Apr 26

2 P's on a Pod: M&A Themes, Software Winners & Retail Reality

2 P's on a Pod: M&A Themes, Software Winners & Retail Reality

Skillcast Group Plc, 44.5 | Sanderson Design Group PLC, 74.5 | Eleco Plc, 128 | Intercede Group plc, 124 | GB Group PLC, 208 | TT Electronics plc, 116 | Tate & Lyle PLC, 512 | Telecom Plus PLC, 986 | Synthomer plc, 105 | Tracsis plc, 338 | ASA International Group PLC, 201 | Ceres Power Holdings plc, 698 | Eagle Eye Solutions Group PLC, 480 | Treatt plc, 302 | Shoe Zone PLC, 57.5 | Warpaint London PLC, 210 | Evoke plc, 45.4 | ActiveOps plc, 243 | DCC Plc, 6,045 | Auction Technology Group PLC, 432

    • 96 views

 
In this week’s live smallcap show, UK equity analyst & markets commentator Paul Scott & I discussed our latest thoughts on 21 stock ideas.

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

Vox Markets Weekly Wrap

Companies: KOOFTCVIDCPIBRESFCHTETMERCVANLWATRMET1MPAL

2 P’s on a Pod: Small Cap Investing with Paul Hill & Paul Scott

Companies: ENSIONDOCARGDWNAMSNWFHIKEXPNSYS1CVSGTRCSRELRSTHVOBRCKSPICCCIHCDOMCERSUPWISE

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

The Exchange with John Chinery (alias the Oak Bloke)

Companies: MSIMPACAVAPGRGEZJECOBKZGASAIGMSPRTCDECFUTRIIGWISE

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

The Exchange with Stuart Widdowson of Odyssean Capital

Companies: GNSGHHFSJWILDIANCCESNTCOAOITFLOSPIXPPATG

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top