• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×
  • 14 Sep 18
title

Most popular equity research this week | 10 - 14 Sep

  • 882 views
Rob Mundy

Helping investors and companies

 
trending research equity research tree
Strap line

See what's trending this week...

Companies: APC, BMS, K6YA, ENT, EUSP, FDM, FNTL, FA/, GMD, GETB, CRPR, K3C, MGP, RLW, TRC, RUA, SEE, SORT, SNX, TIME, TCN, W7L, WATR, XPF


Body

Aortech | APC Technology | Braemar Shipping | James Cropper | Deepmatter | Escape Hunt | EU Supply | FDM | Fireangel Safety Technology | GetBusy | Location Sciences | Private & Commercial Finance | Synectics | Tricorn | Warpaint

Share & share alike | Stockdale, 12 Sep

Paid Access

"Here we go again – the company reporting season is gathering pace. The MPC is likely to leave rates unchanged although expectations still remain for an increase next year. The UK economy expanded at a faster pace in July helped by the weather and better retail sales. General sentiment continues to be impacted by tariff concerns, combined with Brexit uncertainty. As Table 1 shows, all major indices have fallen over the last month. In Share News & Views, we comment on AorTech*, Bonhill*, DeepMatter*, EU Supply* James Fisher, Haynes, Hunting , Location Sciences*, Marshall Motor and Synectics*..."



Seeing Machines (SEE)

Backup-driver Monitoring System | Cenkos, 11 Sep

Paid Access

"Seeing Machines has announced that it has launched a retrofit driver monitoring system for autonomous vehicles called the Guardian Backup-driver Monitoring System (Guardian BdMS). The system is designed to ensure that the backup-driver in a self-driving research vehicle is alert, aware and ready to take control of the driving task whenever necessary..."



Revolution Bars Group (RBG)

A potential corporate development | finnCap, 10 Sep

Paid Access

"After the close on Friday, RBG clarified media speculation that it is in the very preliminary stages of examining a possible acquisition of its key competitor, The Deltic Group (Deltic), further clarifying that is in very early discussions with Deltic about such a combination. The two companies know each other well and were engaged in similar discussions in the second half of 2017, but this does not make a tie-up a certainty. Furthermore, it is difficult to second-guess what the terms..."



Simplybiz (SBIZ)

Interims | Zeus Capital, 11 Sep

Paid Access

"Group revenues rose 13.7% to £24.2m (1H17: £21.3m; 2H17 £22.8m); excluding the £1.8m from the Landmark acquisition and the £0.8m fall in EB software revenue from £3.3m to £2.5m following the re-platforming at Zest, underlying organic revenue grew by 10.6% to £19.9m..."



1PM (OPM)

Successful delivery from enhanced scale | Cenkos, 12 Sep

Paid Access

"Today's results evidence the successful culmination of the buy and build strategy, which has seen a doubling of the business in lending, revenue and profit terms over FY16-18A. Despite material dilution this year, 1pm has also delivered a rise in adj EPS in FY18, highlighting the earnings accretive nature of the acquisitions. We expect this trend to continue and accelerate over the next two years, with earnings increasingly distributed with shareholders under the recently enhanced dividend policy..."



K3 Capital Group (K3C)

Unstoppable market leader proves new model works | finnCap, 11 Sep

Paid Access

"Revenue and EBITDA both ahead of our expectations, resulting in an upgrade to our estimates and price target, which we increase to 375p. This price represents a P/E FY1 of 28x and reflects the company’s market-leading position, conservative management expectations for revenue growth and the company’s innovative use of technology to drive leads. It is also in line with similar ‘exchange’ business models that deliver high EBITDA margins and elevated ROE. K3 Capital continues to move up the deal value chain and now has the ability to potentially increase revenues further through its FCA regulated KBS Capital Markets business..."



Water Intelligence (WATR)

Growth in a critical global market | finnCap, 12 Sep

Paid Access

"Water Intelligence has reported another strong set of results providing further evidence of the scale of the opportunity and ability of management to execute. H1 sales increased +39% on last year and adj. EPS +38%. The group is building a scaleable, technology-backed distribution platform for water solutions in a range of international markets. With the focus on reducing water leakage continuing globally, we see the recent share price weakness as an opportunity..."



Medica Group (MGP)

Buying opportunity in structural growth market leader | N+1 Singer, 12 Sep

Paid Access

"Medica is the UK market leader in teleradiology, providing outsourced image analysis and reporting services to the NHS and private sector. It is benefitting from structural growth in demand for complex medical images and an NHS struggling to manage workflows efficiently. We view the current share price weakness as being temporary and offering a strong buying opportunity..."



Game Digital (GMD)

Part of the retail answer | Edison, 12 Sep

Free Access

"Even as Game Digital (GMD) faces short-term trading pressure, its developing BELONG gaming arena concept is arguably part of the answer of what to do with the UK’s high streets and shopping centres. The first BELONG sites under the February 2018 agreement with Sports Direct are now opening. With GMD’s share price still less than net cash of 32p, neither the existing business, which currently contributes £10m of EBITDA, nor BELONG which we value at 23p, are attributed any value by the market. Our total valuation is 75p..."



GVC (GVC)

Strong current trading, M&A not over yet | AlphaValue, 13 Sep

Paid Access

"GVC released a positive set of H1 results, marked by the strong performance of both EU Retail and Online (sports and gaming). The group’s underlying EBITDA was up 11%, broadly in line with our estimates while the current trading remains strong. The group’s appetite for further bolt-on acquisitions – similar to that of CrystalBet in Georgia – seems intact. Todays’ results confirm that GVC remains one of our top picks in the gambling sector, along with Paddy Power-Betfair..."



GVC (GVC)

Solid 1H18, current trading strong | Whitman Howard, 13 Sep

Paid Access

"A Solid 1H18 from GVC, Football WC18 helped boost margins & volumes. 1H18 Online NGR +20% YoY (led by sports +21%, gaming +19%), resulting in market share gains in key territories. UK retail NGR -3% as reported in previous trading update, Europe retail continues double digit growth NGR +26% (Italy strong). 1H18 proforma group NGR +8% YoY to £1.7bn and proforma EBITDA +11% to £350m; interim divi of 16p (+10%), ex-div 20 September. Further £30m of Capex synergies identified in addition to £130m. 3Q18 update due in October..."



Body Two

Body Three

Body Four

Body Five

The information contained within this post is based on personal experience and opinion and should not be considered as a recommendation to trade nor financial advice.

More Content

More Content

Fintel plc (FNTL LN) - Preclose & upgrade - Corporate

Companies: Fintel PLC

Zeus Capital

Warpaint London - Poised for a fresh look

Companies: Warpaint London PLC

Cavendish

Hybridan Small Cap Feast: 2 February 2026

Companies: CPX IGE RUA GDP HERC CGNR B90 EMVC

Hybridan

Most popular equity research this week | 16 - 20 Oct

Companies: WJASEEPLI600258FARNMYE0CSRTAMSMEGPSYMDPHLGTEKFANCRIMMAGYTSTLCTHBOTBDOTDBVXPSCLPABCFULDNLVLGHZDVECSHOECAKESCSIDPTRCFISHJOULBDRXHCMHCHOF0NR1C4JMLM

Research Tree

Morning Note – 2 February 2026

Companies: DSCV AEP NXQ XPF ELIX NEWS

Cavendish
next
 
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2026

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Allenby Capital
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • EM Spreads
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • Morphose Capital Partners
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS Research Group
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Curious Compounder
      • The Edge Group
      • The Life Sciences Division
      • ThinkFront
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • AlphaValue
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • ISTAR Capital
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • xxxxxx_deleted
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • ABG Sundal Collier
      • ACF Equity Research
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • ISTAR Capital
      • Kepler | Trust Intelligence
      • Longspur Clean Energy
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In