• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×
  • 19 Jan 18
title

Most popular equity research this week | 15 Jan - 19 Jan

  • 1124 views
James Rippon

Contributing Editor

 
AIM-branded Hht air balloon
Strap line

See what's trending this week...

Companies: AA/, ABBY, AIR, BTRW, BWY, BKG, CRN, CAR, CALL, CSP, CRST, 0ROY, HUR, INL, KAPE, MCS, GLE, NEXN, PSN, RDWWF, RIR, SPR, TW/, TEF, VTY, WJG


Body

AIM 2017 - a year to remember

by Stockdale, 17 Jan 

Paid Access


Abbey | Barratt Developments | Bellway | Berkeley Group | Bovis Homes Group | Cairn Homes | Countryside Properties | Crest Nicholson | MJ Gleeson | Inland Homes | Mccarthy & Stone | Persimmon | Redrow | Springfield Properties | Taylor Wimpey | Telford Homes | Watkin Jones

 

"In July 2017, we highlighted the progress that AIM made in the first half of the year. We are now reviewing the performance over H2 2017. The latest AIM Statistics published yesterday show that there are currently 960 companies, with 80 new issues in 2017, raising £1.58bn and secondary issues raising a further £4.7bn. However, with 102 companies cancelling their listing there was a net 22 fall in 2017 as a whole. It appears that both the trends of new issue momentum and de-listings are set to continue in 2018. In Share News & Views, we comment on APC Technology*, ECSC Group* and IG Design."


 

Taptica International (TAP)

Debt reduction | finnCap, 17 Jan 

Paid Access

 

"Taptica has taken advantage of investor demand following the recent positive trading update to raise $30m in an oversubscribed placing in order to reduce its debt. It has issued 4.85m new shares at 450p; approximately 7.7% dilution excluding dormant shares. Furthermore, CEO Hagai Tal has sold 1.65m shares (a further $10m) to pay a CGT liability due on the reorganisation of his holding in 2016. Founder Ehud Levy has also taken the opportunity of strong institutional demand to reduce his exposure to the business through the sale of 2.0m shares. Although there will be some dilution, the placing will strengthen the balance sheet and better position the Taptica for prospective M&A opportunities."


 

Cloudcall Group (CALL)

Initiation of coverage | Arden Partners, 18 Jan 

Paid Access

 

"Arden Partners is soon to initiate full coverage of Cloudcall. We report on the Trading Update RNS released this morning, with full forecasts and initiation report to follow. Cloudcall reported a trading update for the year ending 31 December 2017, confirming the company’s continued execution to plan with revenues and profits in line with market expectations.  Revenue growth and gross margins were sustained, whilst investment into sales, marketing and development capabilities continued, making use of the £5.7m placing in October 2017."


 

Carclo (CAR)

Trading significantly behind; FD, chairman to leave | N+1 Singer, 15 Jan 

Paid Access

 

"After the Interims in November, we said that forecast risk was higher due to the c37:63 H1: H2 PBT weighting, but that management was confident of achieving this. Unfortunately, this has not proved possible and results for FY18 are now anticipated to be significantly below previous expectations. Forecast downgrades are 27% off PBT in both FY18 and FY19. Forecast net debt of £32.9m is 2.1x EBITDA and well within covenant levels (2.75x). The FD and the Chairman are to leave and Mark Rollins, highly regarded by us from his time at Senior, becomes Chairman. There are good businesses within the Group, but there is a long road of confidence rebuilding ahead. We reduce our target price to 91p (P/E of 10x FY18) and move to Hold."


 

Hurricane Energy (HUR)

A fair wind | Arden Partners, 17 Jan 

Paid Access

 

"Hurricane has made a series of large discoveries West of Shetland in fractured basement reservoir. The company is currently implementing the Lancaster EPS development, which is to produce at 17mbbl/d for up to 10 years. This will provide cash flow, and important production data to help demonstrate the commerciality of the over 2.5bn boe of resources that the company has discovered. Over the next 12 months, we expect periodic development updates, culminating in first oil in H1 2019. We have a Buy recommendation and 70p target."


 

Ricardo (RCDO)

Impressive H1 orders. Improved FCF. Upside risks abound | Liberum, 17 Jan 

Paid Access

 

"Organic H1 order intake has increased >25% and >30% on a reported basis. This was generated from a broad range of sectors. Orders relating to electric or hybrid vehicles have been particularly encouraging at around 24% of intake, compared to 17% last year. Furthermore, strong working

capital performance drove net debt down to £32m even after paying for the CPC acquisition. FY estimates have headroom to improve and there are some exciting opportunities within Performance Products. McLaren is a useful reference. The shares currently trade on a CY18 P/E of 15.6x and EV/EBIT of 12.6x. Momentum is building. H1 results will be released on 28 February."


 

Crossrider (CROS)

A strong H2 in line with expectations | Progressive, 16 Jan 

Free Access

 

"Crossrider’s trading update for the year to the end of December 2017 includes revenue and Adjusted EBITDA expectations in line with our estimates. In particular, CyberGhost has continued to perform strongly. The increased level of deferred income reflects Crossrider’s ongoing transition towards a SaaS model - and its repositioning as a consumer security software business. Despite making further acquisition payments of U$7.7 million during the year, the Group ended 2017 with cash of U$69.4 million – the strategy includes making further acquisitions. Growth in Adjusted EBITDA of over 150% from core activities (excluding the discontinued Web Apps and License business) reflects good organic growth across an increasingly geographically-diverse customer base for Crossrider’s core software solutions. We reflect the updates on revenue and the cash position in our FY 2017E estimates and adjust amortisation upwards noting further acquisition costs in H2. The Board says that it is confident of delivering growth in 2018 in line with market expectations."


 

Air Partner (AIR)

Strong H2 trading, 2018E forecasts raised 7% | Liberum, 18 Jan 

Paid Access

 

"Strong trading in the second half has seen management guide to FY underlying PBT of not less than £6.4m for the year to January 2018E (c.25% YoY growth). This is 7% ahead of our previously published forecast and we raise our estimates accordingly. In Broking, there has been notably strong trading in the US and Freight. At this early stage, we consider it prudent to leave forecasts for later years unchanged. We raise our DCFbased target price to 150p from 140p. However, after a 49% share price rise over the past year and on a 2018E P/E of 17x, there is insufficient upside potential to support a positive stance short term. We downgrade our recommendation to HOLD from Buy."


 

Carpetright (CPR)

Post-Xmas slump hits profits, but capacity likely to exit market | N+1 Singer, 19 Jan 

Paid Access

 

"Despite a positive start to Q3, and a raft of self-help and growth initiatives, footfall and LFL sales have slumped since Xmas i.e. the important winter trading period. Compared to single-digit positive LFL growth, sales in core Flooring categories have since dipped to -7.1% in the last 3-4 weeks. While some of this might be weather related, the working assumption is the trend could persist through the remainder of the half. Given the impact of operational gearing, guidance is £2-6m FY18 PBT, a £10m downgrade at the mid-point of the range. Cashflow is also likely to be impacted given the w/c dynamics, although our initial assessment indicates there remains material headroom against the RCF; it also has c£60m freehold property backing. The only positive to be taken from today’s warning is that competition will also be struggling, especially loss-making new entrants. Capacity withdrawal could help CPR recapture lost sales and margin, and the subsequent swing back to the P&L could match the level of downgrades."


 

AA (AA/)

Growth in insurance should drive gradual de-leveraging | Liberum, 19 Jan 

Paid Access

 

"Cold weather in December could adversely impact FY 2018 EBITDA by c. 1%. We expect that Green Flag is winning share against the RAC more than The AA, but weaker new car sales are negative for The AA’s B2B business. No management guidance for 2019 but additional patrols should be self-funding. We continue to expect net capex to increase in FY 2019, but make no change to our estimates. We expect no rights issue to pay down debt. The better route to de-leveraging is to grow EBITDA. We retain our target price of 250p."



Body Two

Body Three

Body Four

Body Five

The information contained within this post is based on personal experience and opinion and should not be considered as a recommendation to trade nor financial advice.

More Content

More Content

MJ Gleeson - Back on track

Companies: MJ Gleeson PLC

Cavendish

Bovis Homes rejects merger with Galliford Try, appoints new CEO

Companies: Vistry Group PLCGalliford Try Holdings PLC

Research Tree

Singer Capital Markets - MJ Gleeson - Delivering growth in difficult markets

Companies: MJ Gleeson PLC

Singer Capital Markets

Most popular equity research this week | 1 - 11 Jan

Companies: SLPUBISMPACNXTALTFDEVALPHCDMGMDGLESPEGFINGTLYBURATVI0IFXKYYWY0QYP0LCX

Research Tree

PROGRESSIVE: Watkin Jones - Earnings beat estimates after ‘resilient’ FY25

Companies: Watkin Jones Plc

Progressive Equity Research
next
 
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2026

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Allenby Capital
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • EM Spreads
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • Morphose Capital Partners
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS Research Group
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Curious Compounder
      • The Edge Group
      • The Life Sciences Division
      • ThinkFront
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • AlphaValue
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • ISTAR Capital
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • xxxxxx_deleted
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • ABG Sundal Collier
      • ACF Equity Research
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • ISTAR Capital
      • Kepler | Trust Intelligence
      • Longspur Clean Energy
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In