• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×
  • 03 Aug 17
title

Most popular equity research this week | 31 Jul - 4 Aug

  • 971 views
Rob Mundy

Helping investors and companies

 
Revolution Bars RBG acquisition
Strap line

See what was trending this week...

Companies: CMS, FTC, GATC, IQE, ITV, MPAY, OMG, TRC, SDG


Body

Revolution Bars Group (RBG)

Morning Note | finnCap, 1 Aug

Gold Access


"Management announced on 31 July that it had received a conditional proposal from Stonegate to acquire the entire issued and to be issued share capital of Revolution Bars at an offer price of 200p in cash per share."

 

 

IQE (IQE)

VCSEL ramp up just the start | N+1 Singer, 31 Jul

Gold Access


"IQE’s trading update confirmed that it has secured multiple, multi-year contracts for VCSEL wafers, which we believe relates to 3D sensing opportunities, the most high profile of which is the 10th anniversary iPhone. We are upgrading our FY’17/’18/’19 EPS forecasts by 5%/6%/10% respectively, however, we believe these forecasts remain very conservative. Assuming a more optimistic level of adoption for the expected new iPhone results in a bull case scenario of 81% EPS upgrades in FY’18. IQE is one of our Key Buys for 2017, a stance which has served us well so far (+185% YTD). With forecasts conservatively struck and multiple additional near-term opportunities outside of Apple on the horizon, we believe the shares will continue to perform. We increase our target price to 147p and retain our Buy recommendation."

 

 

Gattaca (MTEC)

Patient investors paid 7.5% to wait | Equity Development, 3 Aug

Free Access


"Rome was not built in a day. And like most good things, Gattaca’s transition from UK engineering staffer to international recruitment specialist of hard-to-find STEM candidates (Science, Technology, Engineering and Mathematics) is taking slightly longer than anticipated. Not because of any strategic or execution misstep, but largely because of more challenging conditions, which have impacted Net Fee Income (NFI, see below) over the past 3 years."

 

 

Communisis (CMS)

Good H1 progress/forecasts unchanged | Liberum, 3 Aug

Gold Access


"First half results show good progress with underlying EPS growth, further debt reduction, dividend up ahead of forecasts and a constructive outcome from the pension review."

 

 

ITV (ITV)

Finally rather decent within a tough first half context | AlphaValue, 2 Aug

Gold Access


"TV’s H1 17 results were in line with expectations, within a particularly tough environment. Total external revenues declined 3% to £1,458m as ITV Family net advertising’s revenue fell by 8% to £769m (c.53% total group; Q2 was down 7% after -9% over Q1, including a tough basis of comparison due to the FY16 Euro Football Championship), in line with the guidance for an 8-9% decline for the first part of the year. This was counterbalanced by non-NAR being up by 6% with ITV Studios’ revenues rising by 7% to £697m (+0.6% at CER). As expected, the latter reported a 9% decline for its adjusted EBITA, namely reflecting the ongoing and strategic investment in the US scripted business but also due to a difficult basis of comparison (last year’s reporting of The Voice of China)."

 

 

Oxford Metrics (OMG)

Further product innovation at Vicon | N+1 Singer, 3 Aug

Gold Access


"Vicon’s latest product releases and partner collaborations confirm its leading market position and ability to align with emerging technology trends. The launch of Vicon Vertex and partnership with Manus VR expand its presence in high-quality Virtual Reality applications, while the new Cara Lite product extends its reach in the facial capture market. The group continues to target its R&D spend in areas of known customer demand while also leveraging the existing IP within the business."

 

 

Filtronic (FTC)

FY17 results | Panmure Gordon, 1 Aug

Gold Access


"Filtronic, the designer and manufacturer of microwave electronics for the wireless telco market, has announced an impressive set of FY17 results. Revenues were up 160%, principally driven by strong orders from within the Wireless segment (over three-fold increase in revenues). Moreover, Wireless earnings have swung comfortably from loss into profitability. Cash flows were stronger than initially expected and the business ended with net cash of £2.6m (initial PG forecast £1.2m vs net debt of £0.3m May-16)."

 

 

Walker Greenbank (WGB)

Making headway | Edison, 2 Aug

Free Access


"Our estimates show a good step forward in expected FY18 earnings for Walker Greenbank and H117 pre-close statement comments are consistent with this. Underlying progress is being supplemented by acquisition and positive translation effects against the prior year. The rating has risen following recent share price moves but a premium rating is fully justified in our view."

 

 

Mi-Pay Group (MPAY)

Significant contract win de-risks forecasts | Zeus Capital, 3 Aug

Gold Access


"Mi-Pay has announced a significant new contract with an existing client. The contract is for an initial three-year period and was won in a competitive process against the joint incumbent provider. This secures existing revenues and will generate substantial growth in payment transaction value. Over the contract period, it is expected to have a cumulative impact on annualised transaction volumes of c. €100m. Putting this in context, total transaction volumes in FY16 for this client amounted to €25m. We take the opportunity to de-risk forecasts, providing a much higher degree of certainty with regards FY18 and FY19 revenue estimates. "

 

 


Body Two

Body Three

Body Four

Body Five

The information contained within this post is based on personal experience and opinion and should not be considered as a recommendation to trade nor financial advice.

More Content

More Content

Filtronic:Exploiting the growing addressable market

Companies: Filtronic plc

Edison

Most popular equity research this week | 16 - 20 Oct

Companies: WJASEEPLI600258FARNMYE0CSRTAMSMEGPSYMDPHLGTEKFANCRIMMAGYTSTLCTHBOTBDOTDBVXPSCLPABCFULDNLVLGHZDVECSHOECAKESCSIDPTRCFISHJOULBDRXHCMHCHOF0NR1C4JMLM

Research Tree

Hybridan Small Cap Feast: 11 February 2026

Companies: IGR GATC KEFI TPX ZIN RRR RENX APTA FMET GELN

Hybridan

Most popular equity research this week | 23 - 27 Apr

Companies: CLBSUAICCTIQEWMHPHDSDITUNEFLTRENTPTECDEBS

Research Tree

PANMURE LIBERUM: Gattaca: Strong H1 drives another beat

Companies: Gattaca plc

Panmure Liberum
next
 
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2026

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Allenby Capital
      • Alternative Resource Capital
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • EM Spreads
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • Morphose Capital Partners
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS Research Group
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Curious Compounder
      • The Edge Group
      • The Life Sciences Division
      • ThinkFront
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • AlphaValue
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • ISTAR Capital
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • xxxxxx_deleted
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • ABG Sundal Collier
      • ACF Equity Research
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • ISTAR Capital
      • Kepler | Trust Intelligence
      • Longspur Clean Energy
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In