working

Sign in

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account


Sign In
Not a commercial user? Register here for our wider research bundle

More Content

More Content

Balance sheet transformed. Bioseparations performing well. Sharp focus on value driving clinical priorities

Companies: ProMetic Life Sciences

Most popular equity research this week | 16 - 20 Oct

Companies: WJASEEPLI600258FARNMYE0CSRTAMSMEGPSYMDPHLGTEKFANCRIMMAGYTSTLCTHBOTBDOTDBVXPSCLPABCFULDNLVLGHZDVECSHOECAKESCSIDPTRCFISHJOULBDRXHCMHCHOF0NR1C4JMLM

Rights offer terms confirmed. More pre-clinical data on fibrotic lung conditions for both Ryplazim & PBI 4050

Companies: ProMetic Life Sciences

Further strong progress on funding, and regulatory pathway

Companies: ProMetic Life Sciences

Losses down 16.8%. Significant additions to the Board. Plenty of clinical progress expected in H2.

Companies: ProMetic Life Sciences

© Research Tree 2025

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top