Research Tree Research Tree Logo

  • Try our Investor Tool
  • Login
  • Sign Up

Research Tree Logo

  • Login
  • Sign Up
  • Features
  • Pricing
  • RNS/News
  • Contact
  • Try our Investor Tool
  • Login
  • Sign Up
  • Providers
  • Companies
⨯
  • Providers
  • Companies
⨯
  • Features
  • Pricing
  • Event Hub
  • RNS/News
  • Short Interest
  • Contact
Companies >
Canada >
Biotechnology >
ProMetic Life Sciences >
Research >
IND granted for IVIG. Phase III next

  • 26 Oct 2015

IND granted for IVIG. Phase III next


ProMetic Life Sciences (PLI:TSE) | 0 0 1.3% | Mkt Cap: 1,075m


  • Hybridan
    • Derren Nathan

    • 7 pages

Biotechnology image


 
Biotechnology image


Some ten months after submission, ProMetic Life Sciences has today announced that the FDA has cleared its Investigational New Drug application for IVIG (intravenous immunoglobulin) for the treatment of primary immunodeficiency diseases (PIDD). Despite the relatively long approval period, ProMetic is well prepared to move quickly with the majority of clinical sites for the proposed pivotal Phase III study already prepared. We understand the target date for first sales remains 2018. Given that ....


Sign up to access

Get access to our full offering from over 30 providers

Get access to our full offering from over 30 providers


Get Started
Already a member? Log in here
See all the research we have on this company.

IND granted for IVIG. Phase III next


ProMetic Life Sciences (PLI:TSE) | 0 0 1.3% | Mkt Cap: 1,075m


  • Published: 26 Oct 2015
  • Author: Derren Nathan
  • Pages: 7
  • Hybridan


Some ten months after submission, ProMetic Life Sciences has today announced that the FDA has cleared its Investigational New Drug application for IVIG (intravenous immunoglobulin) for the treatment of primary immunodeficiency diseases (PIDD). Despite the relatively long approval period, ProMetic is well prepared to move quickly with the majority of clinical sites for the proposed pivotal Phase III study already prepared. We understand the target date for first sales remains 2018. Given that ....



More Content

More Content

Balance sheet transformed. Bioseparations performing well. Sharp focus on value driving clinical priorities

Companies: ProMetic Life Sciences

Hybridan

Most popular equity research this week | 16 - 20 Oct

Companies: WJASEEPLIFARNCSRTBTGAMSPHTMSYMDPHLGTEKFANCRRGDIMMAGYTSTLCTHBOTBDOTDVERBVXPSCLPABCFULDNLVLGHZDVECSHOECAKEC4XDSCSMTPHIDPRBGFISHHOTCJOULHCMMXCT

Research Tree

Rights offer terms confirmed. More pre-clinical data on fibrotic lung conditions for both Ryplazim & PBI 4050

Companies: ProMetic Life Sciences

Hybridan

Further strong progress on funding, and regulatory pathway

Companies: ProMetic Life Sciences

Hybridan

Losses down 16.8%. Significant additions to the Board. Plenty of clinical progress expected in H2.

Companies: ProMetic Life Sciences

Hybridan

Useful Links

  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub

Account

  • Login
  • Free Trial - Join Now
  • Contact
Follow us on Linkedin Follow us on Twitter

Share:

Heap | Mobile and Web Analytics

Copyright © 2021 Research Tree | All Rights Reserved. | Terms of Service and Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • RNS/News
  • Short Interest Tracker
  • Blogs
    • Academy
    • Insights
    • News
    • Research Tree
    • The Naked Fund Manager
  • Ideas & Picks
    • Ideas Hub
    • Stock Pick League
    • Themes & Screens Hub
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Leisure, Tourism & Travel
      • Media
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Align Research
      • BRR Media
      • Capital Access Group
      • Couloir Capital
      • Edison
      • Equity Development
      • eResearch
      • Exane BNP Paribas - Sponsored Research
      • Fidante Partners
      • Five Minute Pitch TV
      • goetzpartners securities Limited
      • Hardman & Co
      • Independent Investment Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Mello Events
      • piworld.co.uk
      • Proactive
      • Progressive Equity Research
      • QuotedData
      • RaaS - Research as a Service
      • Radnor Capital Partners
      • Research Tree
      • SEAL Advisors Ltd
      • ShareSoc
      • Trinity Delta
      • Yellowstone Advisory
    • High Net Worth Offering
      • Allenby Capital
      • AlphaValue
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Cenkos Securities
      • Couloir Capital
      • Dowgate Capital
      • Exane BNP Paribas - Sponsored Research
      • finnCap
      • First Berlin
      • Hybridan
      • Liberum
      • Longspur Research
      • Louis Capital
      • Medley Global Advisors
      • N+1 Singer
      • Northland Capital Partners
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • The Life Sciences Division
      • VSA Capital
      • WHIreland
      • Whitman Howard
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • Align Research
      • Allenby Capital
      • AlphaValue
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BRR Media
      • Bryan, Garnier & Co
      • Capital Access Group
      • Cenkos Securities
      • Couloir Capital
      • Dowgate Capital
      • Edison
      • Equity Development
      • eResearch
      • Exane BNP Paribas
      • Exane BNP Paribas - Sponsored Research
      • Fidante Partners
      • finnCap
      • First Berlin
      • Five Minute Pitch TV
      • goetzpartners securities Limited
      • Hardman & Co
      • Hybridan
      • Independent Investment Research
      • InterAxS Global
      • Kepler | Absolute Hedge
      • Kepler | Trust Intelligence
      • Liberum
      • London Stock Exchange
      • Longspur Research
      • Mello Events
      • N+1 Singer
      • Northland Capital Partners
      • Numis
      • Peel Hunt
      • piworld.co.uk
      • Proactive
      • Progressive Equity Research
      • QuotedData
      • RaaS - Research as a Service
      • Radnor Capital Partners
      • Research Tree
      • SEAL Advisors Ltd
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • The Life Sciences Division
      • Trinity Delta
      • VSA Capital
      • WHIreland
      • Whitman Howard
      • Yellowstone Advisory
      • Zeus Capital
    • Video/Audio Interviews
      • BRR Media
      • Capital Access Group
      • Couloir Capital
      • Edison
      • Equity Development
      • Five Minute Pitch TV
      • piworld.co.uk
      • Proactive
      • Research Tree
      • Yellowstone Advisory
    • Event Providers
      • Capital Access Group
      • Cenkos Securities
      • Equity Development
      • Hardman & Co
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Mello Events
      • piworld.co.uk
      • QuotedData
      • ShareSoc
      • VSA Capital
      • Yellowstone Advisory
  • Contact
  • Sign Up
  • Sign In