working

Sign up to access

Get access to our full offering from over 30 providers

Get access to our full offering from over 30 providers


Get Started
Already a member? Log in here

More Content

More Content

PANMURE LIBERUM: CEO Video: Jonny Watts, Frontier Developments:

Companies: Frontier Developments Plc

Most popular equity research this week | 21 - 25 August

Companies: PRMHEADIOMAPHAGYEMRSNGTSTLCTHPHDCNSLVANQSDIBVXPINSECOGFDEVYGENABZAEPWNOPTISPEMTFBIHCAVCTLDRUFWX1

Frontier Developments (FDEV LN) - Rollercoaster year

Companies: Frontier Developments Plc

Most popular equity research this week | 19 - 23 Nov

Companies: CMLFPOIQEFA/TSTLFDEVKMKRREFUTRPLUS

PANMURE LIBERUM: Frontier Developments: Pipeline compelling

Companies: Frontier Developments Plc

© Research Tree 2024

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top