working

Sign up to access

Get access to our full offering from over 100 providers

Get access to our full offering from over 100 providers


Get Started
Already a member? Log in here

More Content

More Content

Sylvania Platinum:Strong revenue growth continues

Companies: Sylvania Platinum Ltd.

Most popular equity research this week | 1 - 11 Jan

Companies: SLPUBISMPACNXTALTFDEVALPHCDMGMDGLESPEGFINGTLYBURATVI0IFXKYYWY0QYP0LCX

VSA Capital Morning Miner 240226

Companies: SLPBRESATM

VSA Capital Morning Miner 210223

Companies: SLPBHPBSHVFEST

PANMURE LIBERUM: Sylvania Platinum: Interim Results

Companies: Sylvania Platinum Ltd.

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top