• 30 Sep 20

Open Orphan 'period of integration, restructuring and setting the scene' for future growth

Open Orphan 'period of integration, restructuring and setting the scene' for future growth

hVIVO plc | HVO | 8.2 0 0%

    • 104 views

 

Proactive Analyst Emma Ulkar talks through how Open Orphan (LON:ORPH) performed in the first year.

In the six-month period to June 2020, the company focused on integration and restructuring following its acquisition of lab services and challenge studies specialist hVIVO in January.

The company reported £7.1mln of H1 2020 revenues on a reported basis, (no comparable revenues in H1 2019).

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

hVIVO beats 2025 EBITDA forecasts, eyes growth in 2026

Companies: hVIVO plc

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

2 P’s on a Pod: Small Cap Investing with Paul Hill & Paul Scott

Companies: ENSIONDOCARGDWNAMSNWFHIKEXPNSYS1CVSGTRCSRELRSTHVOBRCKSPICCCIHCDOMCERSUPWISE

hVIVO, Bango, Light Science Technologies, Active Energy, Seeing Machines, Foresight Solar Fund - Small Cap Week in Review

Companies: hVIVO plc

Open Orphan first half: 'period of integration, restructuring and setting the scene' for future growth

Companies: hVIVO plc

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top