• 27 Nov 25

VSA Capital Tech & Transitional Energy 271125

VSA Capital Tech & Transitional Energy 271125

Microlise Group plc, 43.0 | Babcock International Group PLC, 1,074 | James Latham Plc, 990 | Craneware plc, 1,453 | IMI plc, 2,775 | AO World Plc, 89.6 | Cerillion Plc, 1,315 | Invinity Energy Systems PLC, 32.5 | Gelion PLC, 17.5 | Aurrigo International PLC, 71.0 | Equipmake Holdings Plc, 1.2

    • 169 views

 

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

VSA Capital Tech & Transitional Energy 210526

Companies: NVDADPLMSGELUCEIES

2 P’s on a Pod: M&A Premiums, Short Activity & Trends in UK Small Caps

Companies: KOOSDYCLBSIGPIPXMCBCBGSNRSOLICRWAPTDGAMAVANLWATR

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

VSA Capital Morning Miner 110523

Companies: MLPLTHMATM

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

Cerillion (CER) Full year 2022 results presentation - December 2022

Companies: Cerillion Plc

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top