working

Sign up for free to access

Get access to the latest equity research in real-time from 12 commissioned providers.

Get access to the latest equity research in real-time from 12 commissioned providers.


Get Started
Already a member? Log in here

More Content

More Content

Social Network Game Development 21 April 2025

Companies: UBI TTWO GLUU NCTY EA RENN 4751 063080 181710 UBI TTWO PLTK 2432 3632 EA NCTY

Most popular equity research this week | 1 - 11 Jan

Companies: SLPUBISMPACNXTALTFDEVALPHCDMGMDGLESPEGFINGTLYBURATVI0IFXKYYWY0QYP0LCX

Social Network Game Development 17 March 2025

Companies: UBI TTWO GLUU NCTY EA RENN 4751 063080 181710 UBI TTWO PLTK 2432 3632 EA NCTY

Google acquires Looker for $2.6bn, Facebook bans app on Huawei phones, Google’s Stadia priced at cost $10

Companies: 0RIH 0IFX 0QZI

Flexing its new titles and back-catalog muscles

Companies: Ubisoft Entertainment (UBI:EPA)UBISOFT Entertainment (UBI:PAR)

© Research Tree 2025

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top