working

Sign up to access

Get access to our full offering from over 100 providers

Get access to our full offering from over 100 providers


Get Started
Already a member? Log in here

More Content

More Content

Knights Group Holdings - Delivering on its strategic ambitions

Companies: Knights Group Holdings Plc

Knights Group (KGH) Full Year results presentation - July 2024

Companies: Knights Group Holdings Plc

Knights Group Holdings - H126 Trading Update - Delivering on its strategic ambitions 21 Nov 2025

Companies: Knights Group Holdings Plc

Most popular equity research this week | 22 Oct - 2 Nov

Companies: HMIARS9WNBWLVFATYM21WRBMTFAVONCSRTCGSTIDEELMFPOHEADHILSHTGAMSMACFMKLWOXIGAPPSCPARSWSUSTRIVIDZTFDISWMHAMERFPMEMRGRIHDYCKTSXXRKHJHDTRAKSOLGPHDVNETJET2LAMPINECALLHURCAMLAREPCAKGHTWDPIERHAYDCAKENAH7DIGRORGTLYW7LJOGCRDLKEYSGYGINDIIBPORBWABBYFLTRENTGENLFSTSAAGF9QZDTXMFGEEC73SIO7RNOPF

PANMURE LIBERUM: Keystone: Growth reaccelerates, 13% EPS upgrade

Companies: Keystone Law Group Plc

© Research Tree 2025

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top