• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×

working
  • 05 Jul 2022

EuroVision Software-Reseller Channel-Check Survey turns more cautious


SAP SE (SAP:ETR), 0 | AMAZON COM (AMZN:NYSE), 0 | Amazon.com, Inc. (AMZN:NAS), 0 | Microsoft Corporation (MSFT:NAS), 0 | Oracle Corporation (ORCL:NYS), 0 | ADOBE SYSTEMS (ADBE:NYSE), 0 | Adobe Inc. (ADBE:NAS), 0 | ALPHABET INC-CL A (GOOGL:NYSE), 0 | Alphabet Inc. Class A (GOOGL:NAS), 0 | salesforce.com (CRM:NYSE), 0 | Salesforce, Inc. (CRM:NYS), 0 | ServiceNow, Inc. (NOW:NYS), 0 | Workday, Inc. Class A (WDAY:NAS), 0 | Zoom Communications, Inc. Class A (ZM:NAS), 0 | Snowflake, Inc. (SNOW:NYS), 0 | Microsoft Corporation (0QYP:LON), 46,460 | Oracle Corporation (0R1Z:LON), 30,800 | ServiceNow, Inc. (0L5N:LON), 0 | Workday, Inc. Class A (0M18:LON), 0 | Zoom Communications, Inc. Shs A Unsponsored Brazilian Depositary Receipt Repr 0.04 Sh A (Z1OM34:BSP), 0

  • BNP Paribas Exane
    • Slowinski Stefan SS | Castillo-Bernaus Ben BC | Lu Louis LL

    • 46 pages


 

This content is only available within our institutional offering.

Sign in

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account


Sign In
Not a commercial user? Register here for our wider research bundle

EuroVision Software-Reseller Channel-Check Survey turns more cautious


SAP SE (SAP:ETR), 0 | AMAZON COM (AMZN:NYSE), 0 | Amazon.com, Inc. (AMZN:NAS), 0 | Microsoft Corporation (MSFT:NAS), 0 | Oracle Corporation (ORCL:NYS), 0 | ADOBE SYSTEMS (ADBE:NYSE), 0 | Adobe Inc. (ADBE:NAS), 0 | ALPHABET INC-CL A (GOOGL:NYSE), 0 | Alphabet Inc. Class A (GOOGL:NAS), 0 | salesforce.com (CRM:NYSE), 0 | Salesforce, Inc. (CRM:NYS), 0 | ServiceNow, Inc. (NOW:NYS), 0 | Workday, Inc. Class A (WDAY:NAS), 0 | Zoom Communications, Inc. Class A (ZM:NAS), 0 | Snowflake, Inc. (SNOW:NYS), 0 | Microsoft Corporation (0QYP:LON), 46,460 | Oracle Corporation (0R1Z:LON), 30,800 | ServiceNow, Inc. (0L5N:LON), 0 | Workday, Inc. Class A (0M18:LON), 0 | Zoom Communications, Inc. Shs A Unsponsored Brazilian Depositary Receipt Repr 0.04 Sh A (Z1OM34:BSP), 0

  • Published: 05 Jul 2022
  • Author: Slowinski Stefan SS | Castillo-Bernaus Ben BC | Lu Louis LL
  • Pages: 46
  • BNP Paribas Exane


Something has changed in the past 30 days We survey 25+ software resellers every quarter to identify software spending trends by category, as well as by vendor for 14 enterprise software vendors. Our survey is 50% weighted toward Europe and 2/3rds outside of North America. This quarter, we have complimented our survey with discussions with resellers to provide additional context. Overall, spending intentions are starting to be reined in, with cuts being made to headcount and real estate, but Cloud costs look to be next as companies look to ''better police'' their spend after two years of almost indiscriminate spending. Infrastructure over apps Our survey has shown the most incremental demand for BI / Analytics, Workflow Automation and Machine Learning, while Financials and Procurement saw the least incremental demand, with HCM and SCM remaining weak. Amazon Web Services, Snowflake, Microsoft and Google Cloud saw the highest vendor scores, while IBM, SAP, VMware and Workday saw the lowest scores. Overall, infrastructure categories appear to be favoured, while apps have fallen to the bottom of the pile. That said, some niche areas, like payroll solutions that allow for daily pay, are seeing high demand. Other trends - good for ''COVID winners'', but beware of cost optimisation hitting growth After a couple of weak quarters, we saw a bounce for COVID winners Adobe and Zoom. This may be due to companies ''giving up'' on getting employees back to the office as one reseller told us. And while Snowflake has scored very well this quarter (along with data warehousing in general) we are also hearing of more companies looking to optimise Cloud spend, which drove a disappointment at SNOW''s last set of results. As for ServiceNOW, despite Workflow Automation being a high priority, the company specific scores took a step back, as did SAP''s scores. When combined with valuation, survey results support of MSFT and ORCL Outperforms This report contains the results of...

More Content

More Content

Smart Cities 29 September 2025

Companies: HPE HPE SAP MSFT MSFT CRM CRM ERICB ERICB IBM ORCL ORCL ITRI ITRI TCS CSCO CSCO SU SU

Acquisdata

Most popular equity research this week | 1 - 11 Jan

Companies: SLPUBISMPACNXTALTFDEVALPHCDMGMDGLESPEGFINGTLYBURATVI0IFXKYYWY0QYP0LCX

Research Tree

Online Survey Software 15 September 2025

Companies: SPNS SAPNRA SAP SAP SAPH SAP SAPPE 269A ALMER ALMER SAPN SPAI SAPCL SACL 2501 9776 SPNS SRB SAPU SAP SAPT SFL SAPP SAPP SSLG 452430 SAPPHIRE

Acquisdata

VSA Capital Tech & Transitional Energy 290525

Companies: CRWD0R1IAVONAVGCHRTCRWCURYSCTCRMSNOWBCSF

VSA Capital

VSA Capital Technology & Transitional Energy 110925

Companies: ORCLIESAURR

VSA Capital
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • Chrome Extension
  • iOS and Android Apps
  • LLM Feed
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2025

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Edge Group
      • The Life Sciences Division
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • Fox-Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • Align Research
      • Allenby Capital
      • AlphaValue
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • Fox-Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Allenby Capital
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • Kepler | Trust Intelligence
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In