working

Sign in

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account


Sign In
Not a commercial user? Register here for our wider research bundle

More Content

More Content

Morning Note – 8 August 2025

Companies: PEN HCM BLZE

Pension deficit dogs starting to look interesting

Companies: TUINAGYHRGNXRGNCCHT

HUTCHMED - 1H25 interims: Looking ahead to pipeline transformation

Companies: HUTCHMED (China) Limited

Most popular equity research this week | 16 - 20 Oct

Companies: WJASEEPLI600258FARNMYE0CSRTAMSMEGPSYMDPHLGTEKFANCRIMMAGYTSTLCTHBOTBDOTDBVXPSCLPABCFULDNLVLGHZDVECSHOECAKESCSIDPTRCFISHJOULBDRXHCMHCHOF0NR1C4JMLM

PANMURE LIBERUM: HUTCHMED: Lower FY guidance, stronger H2 expected

Companies: HUTCHMED (China) Limited

© Research Tree 2025

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top