• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×
  • 11 Feb 21
title

Looking Ahead – w/c 15th Feb 2021

  • 1009 views
Research Tree

News and commentary covering all the latest events in the City

 
looking ahead
Strap line

Looking Ahead At The Next Week

Companies: AEG, ARBB, CLIG, GATC, GLEN, K3C, MANO, MRLWF, NWG, OCY, PLUS, TRC, SENS, TRI, WJG, WIL


Body

Company news, such as Interim results, Final results, AGM statements, Trading Updates, Capital Markets Days and Live Events, are all recognised by active investors as being spurs that generate interest and dealing activity.


This column highlights some company news that will be announced in the week ahead.


Check out any of the companies mentioned by using the Research-Tree Companies Research link.


A quick assimilation of what various brokers have to say about a particular company, can justify the requirement to delve even deeper into how it operates, its markets and its potential.


 

Monday 15th February

Interims:                     City of London Inv Grp (CLIG), Oncimmune Hldgs (ONC),

Finals:                        None declared

Trading Updates:     None declared

AGM/GMs:                Countrywide (CWD), Keras Resources (KRS), Revolution Bars Grp (RBG), Uniphar (UPR),

Live Event:                None declared.


Research Tree Comment: 

Edward Thomason at N+1 Singer is looking forward to the roll-out to the NHS of the Oncimmune Holdings (ONC) EarlyCDT Lung Test, while analyst Emma Ulker at Zeus Capital suggests that it will raise the platform in care delivery benefitting a higher profile for the group in seeking international partners.

Mark Paddon at finnCap suggests that Revolution Bars Group (RBG) should continue investing in its team, its brands and its guest experience by restarting the group’s refurbishment programme.

 


Tuesday 16th February

Interims:                     BHP Grp (BHP), Blancco Technology Grp (BLTG), K3 Capital Grp (K3C), Pan African Resources (PAF), Petra Diamonds (PDL),

Finals:                        Glencore (GLEN),

Trading Updates:     Ocean Outdoor (OOUT), Safestore Hldgs (SAFE),

AGM/GMs:                Dewhurst (DWHT), Nexus Infrastructure (NEXS), Ovoca Bio (OVB),

Live Event:                None declared.


Research Tree Comment: 

Nik Lysiuk at finnCap put out a 300p Target Price on the shares of K3 Capital (K3C) after upgrading their estimates for the company. Anticipating further progress in 2021.

Analyst Varun Sikka at AlphaValue Research considers the shares of Glencore (GLEN) a Buy, with a 293p Target Price over the next four months. Noting the departure of CEO Ivan Glasenberg, he now anticipates a bigger ‘green’ focus by the mining group.

 


Wednesday 17th February

Interims:                     Transense Technologies (TRT),

Finals:                        British American Tobacco (BATS), Hochschild Mining (HOC), Plus500 (PLUS), Rio Tinto (RIO),

Trading Updates:     Burford Capital (BUR), Gattaca (GATC),

AGM/GMs:                Applegreen (APGN), EQTEC (EQT), Great Western Mining (GMWO),

Live Event:                Manolete Partners (MANO), Marlowe (MRL).


Research Tree Comment: 

Liberum Capital analyst Rahim Karin noted that Plus500 (PLUS) had a strong finish to a record year in 2020. It was a better-than-expected underlying performance in the group’s Q4, due to much better market conditions. He states that the group’s attractive outlook is not reflected in its valuation.

Analyst Paul Hill at Equity Development has concluded that the group has now turned a major corner and that the shares of Gattaca (GATC) could take off over the next few years.

This day will also see a ShareSoc webinar with Manolete Partners (MANO).

On this day Marlowe (MRL) will be holding a Capital Markets Day for investors and equity analysts.


 

Thursday 18th February

Interims:                     Hays (HAS), South32 (S32), Wilmington Grp (WIL),

Finals:                        Barclays (BARC), Indivior (INDV), Moneysupermarket.com Grp (MONY), Primary Health Properties (PHP), Smith & Nephew (SN.),

Trading Updates:     Arbuthnot Banking Group (ARBB), Trifast (TRI),

AGM/GMs:                Aminex (AEX), Norish (NSH), Ormonde Mining (ORM), REACT Grp (REAT), Ridgecrest (RDGC),

Live Event:                City of London Inv Grp (CLIG), Sensyne Health (SENS).


Research Tree Comment: 

Alex de Groote at Radnor Capital Partners suggested after the last AGM Trading Update from Wilmington (WIL) that there is significant value within the group. Just one side, that of Risk and Compliance, could well be worth more than the entire group.

Mark Thomas at Hardman & Co considers it is an anomaly that Arbuthnot Banking Group (ARBB) which is a profitable, well-funded, well-capitalised and strongly growing bank, that is currently priced below book value.

Arden Partners analyst Andrew Simms rates the shares of Trifast (TRI) as a Buy, with a 170p Target Price. There is scope for outperformance given the potential for a restocking cycle and recovery in activity from its low base.

On this day City of London Investment Group (CLIG) will be the subject of a Hardman & Co Q&A presentation, while ShareSoc will be holding a webinar for Sensyne Health (SENS).


 

Friday 19th February

Interims:                     None declared

Finals:                        Kingspan Grp (KGP), NatWest Grp (NWG), Segro (SGRO), TBC Bank Grp (TBCG),

Trading Updates:     None declared

AGM/GMs:                Active Energy (AEG), Energean (ENOG), Petroneft Resources (PTR), Watkin Jones (WJG),

Live Event:                None declared.


Research Tree Comment: 

David Grinsztajn at AlphaValue Research considered that NatWest Group (NWG) was a Sell when the banking group announced its Q3 results at the end of last October. However, he did state that his forecasts were under review with likely upgrades in perspective driven by loan impairments and operating expenses.


Ian Jermin at Allenby Capital earlier this month published a note upon Active Energy (AEG) as it restructures its capital and fund raise in anticipation of further positive developments with its ground-breaking CoalSwitch technology. He commented upon the interest being shown by utility and power companies both before and following the recently announced supply agreement with PacifiCorp. This day’s General Meeting is to approve the company’s plans to cope with an acceleration in its activities.


Alastair Stewart at Progressive Research commented that the second half performance by Watkin Jones (WJG) impacted the group’s full year results to end September 2020. He believes that the groups should continue to benefit from growth opportunities in new student accommodation, and that it has ‘early mover advantage’ in build-to-rent.


Body Two

Body Three

Body Four

Body Five

The information contained within this post is based on personal experience and opinion and should not be considered as a recommendation to trade nor financial advice.

More Content

More Content

Morning Note – 12 February 2026

Companies: TRI TPX GLE IHC

Cavendish

Hardman & Co Monthly: January 2026

Companies: NBPE ACSO ICGT ARBB RECI VTA

Hardman & Co

Trifast - 3Q update confirms on track for FY26 expectations

Companies: Trifast plc

Cavendish

Most popular equity research this week | 16 - 20 Oct

Companies: WJASEEPLI600258FARNMYE0CSRTAMSMEGPSYMDPHLGTEKFANCRIMMAGYTSTLCTHBOTBDOTDBVXPSCLPABCFULDNLVLGHZDVECSHOECAKESCSIDPTRCFISHJOULBDRXHCMHCHOF0NR1C4JMLM

Research Tree

Hybridan Small Cap Feast: 11 February 2026

Companies: IGR GATC KEFI TPX ZIN RRR RENX APTA FMET GELN

Hybridan
next
 
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2026

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Allenby Capital
      • Alternative Resource Capital
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • EM Spreads
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • Morphose Capital Partners
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS Research Group
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Curious Compounder
      • The Edge Group
      • The Life Sciences Division
      • ThinkFront
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • AlphaValue
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • ISTAR Capital
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • xxxxxx_deleted
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • ABG Sundal Collier
      • ACF Equity Research
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • ISTAR Capital
      • Kepler | Trust Intelligence
      • Longspur Clean Energy
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In