• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×
  • 24 Aug 18
title

Most popular equity research this week | 20 - 24 Aug

  • 880 views
Rob Mundy

Helping investors and companies

 
Game Digital Research Reports
Strap line

See what's trending this week...

Companies: AIR, ANG, 7IG, COST, ENT, EVOK, FLTR, GMD, GAN, GIG, 7KB, KMK, TJW, MYSL, NKTN, PTEC, SPE, SPOZF, WEY, WMH


Body

Game Digital (GMD)

FY18E gross margin pressure, but net cash beats | Liberum, 21 Aug

Paid Access

"GAME's year-end update highlights a continuation of the H1 trends, which leads us to lower our adjusted EBITDA forecasts by 8%-10%. Pre-Owned Software, which is higher margin, continued to be challenging with this impact more than offsetting continued growth in Mint Hardware and Digital..."



Game Digital (GMD)

Pressures countered: BELONG moves ahead | Edison, 21 Aug

Free Access

"Game Digital (GMD) has finished its year with cost measures countering trading pressures and with BELONG moving into action as the first, larger, sites open. The clearer future represented by BELONG is not reflected in the share price, which remains less than cash..."



Angling Direct (ANG)

FY19E Interim Trading Update | Cenkos, 21 Aug

Paid Access

"Angling Direct has announced a trading update for H1/19E guiding to performance ahead of expectations. Revenue for H1/19E increased 56% YoY, ahead of our full-year run-rate of c37%. The German website was successfully launched in Jun-18, providing an additional platform for continued growth..."



GVC | William Hill | Paddy Power Betfair | Playtech | Sportech | 888 | GAN | Nektan | KAMBI GROUP | GAMING INNOVATION | SCIENTIFIC GAMES | International Game Tech

Off to the races as NFL season draws closer | Whitman Howard, 21 Aug

Paid Access

"The US sports betting market has the potential to be significantly large. However, lack of federal level legislation, sluggish state by state legislative processes, and other limiting factors will cause a likely drag on the sport betting market’s full potential. The American Gaming Association estimates at least $150bn is wagered annually with offshore books, which implies a $10bn - $12bn revenue market. We estimate, onshore online sports revenue in 4 - 5 years of $6bn (table 6, p14) should be achievable across 25 States..."



Sopheon (SPE)

Interims set the pace for another good year | finnCap, 23 Aug

Paid Access

"Interims to June confirm continuing strong performance identified at the July trading update, achieving 51% of forecast FY revenue (1H17: 44%) and 58% of FY EBITDA (1H17: 38%), with visibility over FY contracted revenue already at 88% of full-year expectations (71% this time last year). Net cash is very strong at $15.5m, with 84% of FY free cash flow expectations achieved through the unwind of a build-up in 4Q17 working capital typical of a model which remains dominated by perpetual licences..."



Sopheon (SPE)

Strong first half performance | Progressive, 23 Aug

Free Access

"In line with its July trading update, Sopheon has reported a strong first half performance with revenue, EBITDA and profit before tax well ahead of H1 2017 and representing over half of our respective FY 2018E numbers. Impetus from good growth during 2017 was augmented by new customer wins in the first half of 2018 which were some 50% ahead of those achieved in the comparator period. Sopheon has also continued to expand its “lifetime value” opportunities across a number of blue chip clients through extending the business application areas addressed by Accolade..."



Kromek Group (KMK)

Scaling up production | Cenkos, 20 Aug

Paid Access

"A spate of contract newsflow is increasing revenue visibility over this year. Some new and incremental addressable markets are being discovered for Kromek's CZT based detection equipment. The footprint of the business is steadily increasing and its size will be enhanced materially as the US manufacturing facility ramps up this fiscal year..."



Air Partner (AIR)

Encouraging H1 trading update | Liberum, 24 Aug

Paid Access

"The H1 pre-close update has revealed an encouraging start to the year with trading in line with management’s expectations and the performance in H1 last year. The US and Freight have continued to deliver strong performances after good recruitment in previous periods..."



Mysale Group (MYSL)

Valuation drop at odds with platform development and peer M&A | N+1 Singer, 24 Aug

Paid Access

"MySale continues to deliver on its strategy and, as stated at the H1 pre-close, better than expected margin gains and operating leverage drives EBITDA at least to the top end of expectations (+37% YoY). Further efficiencies and leverage are anticipated next year too. While 10% sales growth was slightly lower than hoped, future growth potential remains.."



Wey Education (WEY)

Significant progress, net cash ahead, moderating FY19E forecasts | WHIreland, 23 Aug

Paid Access

"WEY is an educational group operating a range of fully interactive educational establishments, including the only online secondary school in the UK. This morning’s update from the company highlights healthy growth in the underlying and acquired businesses, with sales at InterHigh ahead by 20% YoY and the Academy 21 acquisition successfully integrated and delivering +25% revenue growth on the same basis..."



Costain Group (COST)

EPS up 16% and estimate increased 3% | Liberum, 22 Aug

Paid Access

"H1 FD EPS up 16% with a shift away from large capital projects and particular strength in Natural Resources. New HE connected vehicle technology contract yesterday illustrates shift towards technology..."



Body Two

Body Three

Body Four

Body Five

The information contained within this post is based on personal experience and opinion and should not be considered as a recommendation to trade nor financial advice.

More Content

More Content

Unsurprising report and credible guidance

Companies: KAMBI GROUP (KAMBI:STO)Kambi Group plc Class B (KAMBI:OME)

ABG Sundal Collier

Most popular equity research this week | 23 - 27 Apr

Companies: CLBSUAICCTIQEWMHPHDSDITUNEFLTRENTPTECDEBS

Research Tree

MIXI Inc. (2121) Q3 FY3/26 results update: Growth engine emerging

Companies: ALL 3765 6460 JUVE 4751 CCP FLTR ENT 9672 063080 251270 2121 3668 9766 2432 MANU DKNG

Astris Advisory

Most popular equity research this week | 1 - 11 Jan

Companies: SLPUBISMPACNXTALTFDEVALPHCDMGMDGLESPEGFINGTLYBURATVI0IFXKYYWY0QYP0LCX

Research Tree

Morning Note – 27 January 2026

Companies: 88E GENI ELCO DOTD COST TIME XSG LORD VINO

Cavendish
next
 
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2026

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Allenby Capital
      • Alternative Resource Capital
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • EM Spreads
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • Morphose Capital Partners
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS Research Group
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Curious Compounder
      • The Edge Group
      • The Life Sciences Division
      • ThinkFront
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • AlphaValue
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • ISTAR Capital
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • xxxxxx_deleted
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • ABG Sundal Collier
      • ACF Equity Research
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • ISTAR Capital
      • Kepler | Trust Intelligence
      • Longspur Clean Energy
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In