• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×
  • 02 May 17
title

THE NAKED FUND MANAGER - Why the best businesses have great cash conversion

  • 4870 views
The Naked Fund Manager

UK-focused Small and Mid-cap fund manager.

 
Cash Flow Growth Profile across UK listed equities in 2015 and 2016
Strap line

The top 20 companies using the CF Growth Profile beat the bottom 20 by 16% pa over last two years

Companies: CRW, INF, IOM, JE/, MCRO, OTB, PTEC, PHD, RKT, REL, RMV, 0GD5, ZPG


Body

 

Afternoon all,


This week I’ll be looking at a company’s cash cycle. This is a critical factor you need to understand when looking at businesses. I use a very useful framework that measures the free cash generation per unit of revenue growth and examine the whole of the UK listed universe, highlighting a few companies that screen well.


A feature of many great business models is a rapid cash conversion cycle, and the very best even have negative operating working capital. Hence, as their revenue grows, cash generation rises even faster. This is the holy grail for many companies because it means business growth is funded by the customer rather than debt or equity.


There is an excellent book by John Mullins that I would highly recommend called The Customer-Funded Business which goes into customer-funded business models in detail, while still being very readable. It is directed more at startups than established companies, but it does an excellent job in demonstrating the benefits of customer funding and a healthy cash conversion cycle.

 

 

Charles Mulford’s “Cash Flow Growth Profile.”

Charles Mulford is a professor at Georgia Tech who has done a lot of work on analysing corporate cash flows. He developed the framework which he dubbed “Cash Flow Growth Profile”. It is an excellent way to systematically look at a lot of companies and get a feel for how much free cash should be generated per unit of revenue growth.


As with many of the best frameworks, it is simple and easy to implement. In short, it puts most of the key moving parts in the cash flow statement in terms of a percentage of revenue and then builds them up to finish with a view of free cash per unit of sales.


Cash Flow Growth Profile = EBITDA margin - Operating Working Capital/Revenue - Capex/Revenue - Tax/Revenue


In English, the above is effectively breaking up free cash flow into the gross cash generation, the working capital burden, the capex and the tax, all as a percentage of revenues. This is a useful framework as it allows you to quickly see how much of a company’s cash generation is down to margin, how much is generated or used by operations via Working Capital, and how much is needed for capex and tax.


Operating working capital as a percentage of revenue shows how much funding is needed to support operations, or critically, how much a business can organically fund growth. It is calculated as Accounts Receivable + Inventory - Accounts Payable.


If the business receives cash upfront from customers but doesn’t pay suppliers for a couple of months, then the cash cycle is highly beneficial in that receivables will be low versus payables and could yield a negative operating working capital position. Greater revenues then lead to higher levels of “float” as Warren Buffett calls it, the best source of internal funding. 


 

How do UK-listed shares stack up?

I have examined the profile of all the equities listed in the UK, both in 2015 and 2016 to see which companies stand out as having a great Cash Flow Growth Profile. As with any of these frameworks, they don’t work for all businesses, so I’ve stripped out negative EBITDA margin companies and those with revenue growth less than 10%. After all, if revenues are growing at a glacial rate or worse, then the benefits of a healthy cash cycle are less relevant to growth.


I also filter out some of the less relevant sectors such as:

  • Trusts & Funds,
  • Asset Management,
  • Biotech,
  • Oil & Gas,
  • Mining,
  • Real Estate,
  • Banks, and
  • Insurance.

The above filters cut the list of equities from c.1,500 down to c.370 shares of interest. I’ve ranked them from best to worst for each of 2015 and 2016 and aggregated the scores into a combined rank.


Below are the full results plotted on a scatter graph, plotting the 2016 Cash Flow Growth Profile:


 

Full rank of UK listed companies according to their Cash Flow Growth profile


Interestingly if you look at how the top 20 companies (blue dots) in the rank fared over the last two years compared to the bottom 20 companies (red dots), there is a clear outperformance.


 

Top 20 UK companies by cash flow growth profile materially outperformed bottom 20 over 2015 and 2016


The average total return across the top 20 was 26% per annum for the years April 2015-16 and April 2016-17. However, the bottom 20 ranked companies had an average total return of 10% per annum. That’s a 16% outperformance each year.

 

Furthermore, the clustering is far healthier for the top 20 companies compared to the bottom 20 (which you can see above are all over the place).


Here are the top 25 companies in more detail:


top 25 UK listed companies by Cash Flow Growth Profile, 2015 2016


As you can see, many of these business models have healthy EBITDA margins (or Operating Cushions). What’s more interesting is they all have strongly negative operating working capital positions.


The platform companies unsurprising look good on these metrics with Rightmove, Just Eat and ZPG. JE’s negative operating working capital of -33% is a very healthy cash flow model. ZPG’s is still good, albeit lower at -16%.


On The Beach is another example of a high growth, capital light business whose cash cycle means that 70% of revenues are converted into core cash for the firm, with little in the way of capex obligations to use up that cash.


Iomart is an exciting cloud services consultancy with decent EBITDA margins of 40+% and a negative working capital model (although the numbers are slightly flattered here by a high current borrowings figure).


UBM is a global event organiser. Its business model generates an ok EBITDA margin of 24%, but cash is received more or less upfront from customers and not paid to suppliers til much later, driving a 44% of revenues converting into core cash.

 

 

-----

 

To read a brief outline of how I think about stocks, and what I aim to achieve in this blog, please check out my first blog where I set out my stall.

 

Recent blogs:

  • 10 Apr 17 - Platforms are taking over the world
  • 3 Apr 17 - Bingo player Jackpotjoy offers interesting upside...and risk
  • 27 Mar 17 - What Banks and Brokers can learn from Amazon
  • 20 Mar 17 - Why understanding behavioural finance is just as important as stock picking
  • 14 Mar 17 - What to make of Challenger Banks
  • 6 Mar 17 - CFD platforms still worth a look
  • 27 Feb 17 - Purplebricks US expansion: How big is the opportunity?
  • 20 Feb 17 - M&A - One reason why I’m still bullish on UK equities
  • 14 Feb 17 - Anatomy of a growth company
  • 6 Feb 17 - Roll-outs: the Good, the Bad and the Ugly
  • 30 Jan 17 - How MiFID II could hurt Small and Mid-caps
  • 23 Jan 17 - Why Pearson was an obvious value trap, and is Jackpotjoy worth a closer look?
  • 16 Jan 17 - How sustainable are current dividends
  • 8 Jan 17 - Implications of Trumponomics for equities
  • 18 Dec 16 - Millennials - Becoming the most important demographic
  • 12 Dec 16 - CFDs - Tough week but worth a closer look
  • 5 Dec 16 - Pension deficit dogs starting to look interesting
  • 28 Nov 16 - Setting out my stall...plus my thoughts on bond proxies 

Please Note: To be clear, I do not and will not ever give any advice. I will rarely mention individual stocks but when I do these will not be recommendations, instead just my thoughts at that point in time.

 


Body Two

Body Three

Body Four

Body Five

The information contained within this post is based on personal experience and opinion and should not be considered as a recommendation to trade nor financial advice.

More Content

More Content

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

Vox Markets

Most popular equity research this week | 3-7 July

Companies: 21WAVONELMHRIHILSHVNSNXSTJSNRIQEFA/GKNBLTGCTHSFRCVSGBBSNEUSPSERVNOGFDM7DIGINFRWSOTBPRSMRTHMMYSLHCMSQSE3CDQ6NEXNRNUGFPPIXQRT0RSPPOLYRNOPF

Research Tree

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

Vox Markets

2 P’s on a Pod: M&A Premiums, Short Activity & Trends in UK Small Caps

Companies: KOOSDYCLBSIGPIPXMCBCBGSNRSOLICRWAPTDGAMAVANLWATR

Vox Markets

PANMURE LIBERUM: The Panmure Liberum Leisure Digest: Geopolitics, fuel costs and confidence test leisure resilience

Companies: JDW MAB MARS WTB FSTA YNGA BOWL CPG SSPG SHEP OTB HSW TMO GYM MEX

Panmure Liberum
next
 
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2026

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Allenby Capital
      • Alternative Resource Capital
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • EM Spreads
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • Morphose Capital Partners
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS Research Group
      • RBC Capital Markets
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Curious Compounder
      • The Edge Group
      • The Investor Summit
      • The Life Sciences Division
      • ThinkFront
      • Ticker TV
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Venn Brown
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • Fox Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • AlphaValue
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • xxxxxx_deleted
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • Fox Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • Kepler | Trust Intelligence
      • Longspur Clean Energy
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In