• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×
  • 31 Aug 18
title

Most popular equity research this week | 27 - 31 Aug

  • 746 views
Rob Mundy

Helping investors and companies

 
IG Desig Group
Strap line

See what's trending this week...

Companies: AFHP, BKS, CHH, FFHHF, IGR, MYSL, 3BE, WJA, WJG


Body

IG Design Group (IGR)

Combining Design & Innovation | Cenkos, 28 Aug

Paid Access

"IG Design has announced the conditional acquisition of Impact Innovations Inc, in the USA funded by the first tranche of a two part £50.0m placing. A successful acquisition of Impact is expected to make IG Design the largest consumer Gift Packaging business in the world, doubling IG Design's US revenue. IG Design intends to buy 100% of Impact on a debt-free/cash-free basis for £56.5m, on a EV/EBITDA of 4.9x..."



IG Design Group (IGR)

Acquiring Impact | Progressive, 28 Aug

Free Access

"IG Design (“Design Group”) have announced that they will acquire Impact Innovations Inc in the US. This is a strategically transformative deal which will create considerable operational and procurement cost savings as well as offering the potential for cross-selling existing IG product to Impact’s customer base and vice-versa. It also gives the combined business a presence and scale in the US which would justify further investment, both organic and as a consolidator of a fragmented regional market..."



Beeks Financial Cloud (BKS)

Final results comment | Cenkos, 29 Aug

Paid Access

"Beeks Financial Cloud announced final results for the year to June 2018 showing strong increases in revenue and profitability. Beeks enjoys high levels of subscription based revenues, with annualised committed monthly recurring revenue up 47% to £6.9m. We forecast 2019E revenue growth of ..."



Mysale Group (MYSL)

Shares off 40% since solid July pre-close trading update creates opportunity | Zeus Capital, 28 Aug

Paid Access

"Since issuing a reassuring pre-close trading update in July, MySale’s shares have declined 40% resulting in a year-to-date drop of 62%, which looks completely unwarranted in our view given the company’s confident outlook. In the trading update, underlying EBITDA for FY18 (June) is expected to be at least A$11.8m, ahead of our prior forecast of A$11.5m..."



eServGlobal (ESG)

Signs of recovery for core PayMobile business | finnCap, 31 Aug

Paid Access

"As revealed in the early-August update, the H1 performance suggests the core PayMobile mobile money business has turned a corner, with hopes of achieving H2 cash profit and perhaps a cash breakeven for the FY. Management continues to focus on reducing the cost base and a sales strategy targeting a return to growth; this is reflected in an adj. LBITDA of A$1.4m, compared with A$6.0m adjusted loss in H1 LY (to April 2017)..."



Watkin Jones (WJG)

Two new sites boost forward visibility | Equity Development, 29 Aug

Free Access

"The UK’s 67m population is growing at a healthy 1% pa clip, albeit there was a slight dip in the birth rate at the turn of the Millennium (see below). Leading this year to a 3% fall in the number of 18 year olds, and a 1.9% decline in British students accepting places at University (UCAS). Offset partially by a 3%-4% increase in overseas applications, leaving the total 2018/19 freshers’ intake very marginally lower (-1.1%) at c. 530k..."



FFI Holdings (FFI)

FY a little ahead but estimates reduced | Liberum, 31 Aug

Paid Access

"FY EBIT a little ahead and underlying FD EPS increased 69% to 8.1c vs our estimate of 6.4c. Net cash in line with expectations. FY 2019 and 2020 FD EPS estimates reduced 22% and 19%..."



Churchill China (CHH)

Continuing to dish out premium growth | N+1 Singer, 30 Aug

Paid Access

"Churchill has reported an excellent set of interims, delivering 22% PBT growth vs a stiff 31% comp. Key tenets of this growth were geographical diversity and continued sales momentum of value-added products. Looking forward, the business is trading well, investing appropriately, strengthening the international platform and, in our view, European growth should continue to prosper under either Brexit scenario..."



AFH Financial Group (AFHP)

HTH, bought for 6x, is 19% accretive. TP up 28% to 507p | Liberum, 28 Aug

Paid Access

"AFH has announced its eleventh and largest acquisition of FY18, paying c. 6x earnings for HTH Ltd. This is a large acquisition, adding some 10% to 2017 revenues and 19% to profits, while the 6x multiple paid is in line with recent deals..."



Trinity Exploration & Production (TRIN)

Hits the ground running | Whitman Howard, 30 Aug

Paid Access

"Trinity has announced this morning that is has spudded the first new well, of a six infill well programme onshore Trinidad, proving that following its recent fundraising, Trinity is able and willing to move quickly to start unlocking value. We reiterate our BUY recommendation..."



Body Two

Body Three

Body Four

Body Five

The information contained within this post is based on personal experience and opinion and should not be considered as a recommendation to trade nor financial advice.

More Content

More Content

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

Vox Markets

PROGRESSIVE: Beeks Financial Cloud Group - Trading update: In-line, doing fine

Companies: Beeks Financial Cloud Group Plc

Progressive Equity Research

The Exchange with Gervais Williams of Premier Miton

Companies: TUNACGENSIONDOCNCPGHELCOMEGPZTFPAYEOGSRTBVXPCYANNIOXYU/BKSTBTGCTAMPALLST

Vox Markets

Vox Markets Video Wrap

Companies: QDEALUVTYCHHTIDEDGEAVGIQESFTITRKANCRITMJET2EXPNDNLMPINEFRASEZJHVOFDEVBBSNRMVGMSBRCKTUNEAUTOBKSPMIDCCSAGACLXRPIVRCIWISE

Vox Markets

Hybridan Small Cap Feast: 30 April 2026

Companies: NCYT IGR TON AAU VTU PXEN

Hybridan
next
 
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2026

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Allenby Capital
      • Alternative Resource Capital
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • EM Spreads
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • Morphose Capital Partners
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS Research Group
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Curious Compounder
      • The Edge Group
      • The Investor Summit
      • The Life Sciences Division
      • ThinkFront
      • Ticker TV
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Venn Brown
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • Fox Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • AlphaValue
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • xxxxxx_deleted
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • Fox Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • Kepler | Trust Intelligence
      • Longspur Clean Energy
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In