• 17 Apr 26

Vox Markets Video Wrap

Vox Markets Video Wrap

Quantum Data Energy PLC, 1.2 | Alumasc Group plc, 250 | Vistry Group PLC, 268 | Churchill China plc, 332 | Crimson Tide Plc, 99.0 | Diageo plc, 1,605 | Avingtrans plc, 660 | IQE plc, 46.2 | Software Circle PLC, 15.7 | Intertek Group plc, 5,492 | Animalcare Group PLC, 332 | ITM Power PLC, 170 | Jet2 PLC, 1,115 | Experian PLC, 2,592 | Dunelm Group plc, 777 | Pinewood Technologies Group PLC, 252 | Frasers Group PLC, 725 | easyJet plc, 366 | hVIVO plc, 8.1 | Frontier Developments Plc, 406 | Brave Bison Group Plc, 83.0 | Rightmove plc, 441 | Gulf Marine Services PLC, 19.5 | BRCK Group PLC, 46.6 | Focusrite PLC, 188 | Autotrader Group PLC, 459 | Beeks Financial Cloud Group Plc, 155 | Premier Miton Group Plc, 36.5 | DCC Plc, 6,170 | Saga plc, 559 | Calnex Solutions Plc, 72.0 | Raspberry PI Holdings plc, 705 | Verici Dx Plc, 0.4 | Wise PLC Class A, 934

    • 4 views

 
Keeping you informed with the latest company updates and investment insights from renowned stock market professionals

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

2 P’s on a Pod: Small Cap Investing with Paul Hill & Paul Scott

Companies: ENSIONDOCARGDWNAMSNWFHIKEXPNSYS1CVSGTRCSRELRSTHVOBRCKSPICCCIHCDOMCERSUPWISE

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

Q&A: hVivo’s Mo Khan on the company’s latest mega-deal

Companies: hVIVO plc

VSA Capital Tech & Transitional Energy 140526

Companies: AVONAVGBABIMIGAMAIESAURR

2 P’s on a Pod: Small Cap Investing with Paul Hill & Paul Scott

Companies: ALUCRPRAVGIQEITRKANCRITMDNLMEZJHVOFDEVGMSBRCKPMIBOOMCLXRPI

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top