• 14 May 26

VSA Capital Tech & Transitional Energy 140526

VSA Capital Tech & Transitional Energy 140526

Avon Technologies PLC, 1,745 | Avingtrans plc, 670 | Babcock International Group PLC, 1,086 | IMI plc, 2,789 | Gamma Communications PLC, 964 | Invinity Energy Systems PLC, 34.0 | Aurrigo International PLC, 72.5

    • 80 views

 

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

Vox Markets Weekly Video Wrap

Companies: ACGPEBAMSZTFLSLBOWLXPFBRESHDDAPTDGAMASCTBKSPPHCLXMEXWISECTA

Vox Markets Video Wrap

Companies: QDEALUVTYCHHTIDEDGEAVGIQESFTITRKANCRITMJET2EXPNDNLMPINEFRASEZJHVOFDEVBBSNRMVGMSBRCKTUNEAUTOBKSPMIDCCSAGACLXRPIVRCIWISE

2 P's on a Pod: What’s Next in UK M&A?

Companies: PEBAMSZTFLSLCPIBOYBOWLXPFHDDGAMASCTBKSPPHCLXMEXWISECTA

2 P’s on a Pod: M&A Premiums, Short Activity & Trends in UK Small Caps

Companies: KOOSDYCLBSIGPIPXMCBCBGSNRSOLICRWAPTDGAMAVANLWATR

VSA Capital Tech & Transitional Energy 210526

Companies: NVDADPLMSGELUCEIES

Avingtrans - Vox Markets Fund Manager Series: Stephen English of Stellar Asset Management

Companies: Avingtrans plc

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top