• 28 May 26

2 P's on a Pod: What’s Next in UK M&A?

2 P's on a Pod: What’s Next in UK M&A?

Pebble Beach Systems Group PLC, 27.0 | Advanced Medical Solutions Group plc, 223 | Zotefoams plc, 417 | LSL Property Services plc, 224 | Capita plc, 397 | Bodycote plc, 818 | Hollywood Bowl Group Plc, 306 | XP Factory PLC, 17.8 | Hardide plc, 64.5 | Gamma Communications PLC, 965 | Softcat Plc, 1,704 | Beeks Financial Cloud Group Plc, 152 | PPHE Hotel Group Limited, 1,984 | Calnex Solutions Plc, 69.5 | Tortilla Mexican Grill Ltd., 76.5 | Wise PLC Class A, 961 | CT Automotive Group Plc, 35.0

    • 68 views

 
In this week’s live smallcap show, UK equity analyst & markets commentator Paul Scott & I discussed our latest thoughts on 19 stock ideas.

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

Vox Markets Weekly Video Wrap

Companies: ACGPEBAMSZTFLSLBOWLXPFBRESHDDAPTDGAMASCTBKSPPHCLXMEXWISECTA

Vox Markets Video Wrap

Companies: QDEALUVTYCHHTIDEDGEAVGIQESFTITRKANCRITMJET2EXPNDNLMPINEFRASEZJHVOFDEVBBSNRMVGMSBRCKTUNEAUTOBKSPMIDCCSAGACLXRPIVRCIWISE

VSA Capital Tech & Transitional Energy 280526

Companies: SSEIQECHRTBOYHDDCCCRBOTCLX

2 P’s on a Pod: M&A Premiums, Short Activity & Trends in UK Small Caps

Companies: KOOSDYCLBSIGPIPXMCBCBGSNRSOLICRWAPTDGAMAVANLWATR

Vox Markets Weekly Wrap

Companies: KOOFTCVIDCPIBRESFCHTETMERCVANLWATRMET1MPAL

2 P’s on a Pod: Small Cap Investing with Paul Hill & Paul Scott

Companies: ENSIONDOCARGDWNAMSNWFHIKEXPNSYS1CVSGTRCSRELRSTHVOBRCKSPICCCIHCDOMCERSUPWISE

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top