• 13 Apr 26

The Exchange with Jamie Ward

The Exchange with Jamie Ward

Alumasc Group plc, 250 | Vistry Group PLC, 268 | Churchill China plc, 332 | Crimson Tide Plc, 99.0 | Diageo plc, 1,605 | Software Circle PLC, 15.7 | Jet2 PLC, 1,115 | Experian PLC, 2,592 | Pinewood Technologies Group PLC, 252 | Frasers Group PLC, 725 | Sage Group plc, 879 | Brave Bison Group Plc, 83.0 | Focusrite PLC, 188 | Autotrader Group PLC, 459 | Beeks Financial Cloud Group Plc, 155 | DCC Plc, 6,170 | Rosebank Industries Plc, 349 | Wise PLC Class A, 934

    • 79 views

 
In this week’s live Exchange, professional investor & ex-fund manager, Jamie Ward discussed his latest thoughts on the following

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

VSA Capital Tech & Transitional Energy 210526

Companies: NVDADPLMSGELUCEIES

Morning Report: Mike Ashley’s Sports Direct to keep its stores open despite lockdown

Companies: Frasers Group PLC

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

Vistry (VTY) - Vox Markets Fund Manager Series: Richard Penny of CRUX Asset Management

Companies: Vistry Group PLC

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

FTSE 100 starts week on the back foot; Frasers rises as Ted Baker axes last shops - Market Report

Companies: Frasers Group PLC

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top