• 05 Mar 26

VSA Capital Tech & Transitional Energy 050326

VSA Capital Tech & Transitional Energy 050326

Netcall plc, 126 | Senior plc, 287 | SRT Marine Systems plc, 88.5 | Craneware plc, 1,453 | Rosebank Industries Plc, 349 | XP Power Ltd., 1,899 | Aurrigo International PLC, 71.0 | Equipmake Holdings Plc, 1.2

    • 124 views

 

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

2 P’s on a Pod: M&A Premiums, Short Activity & Trends in UK Small Caps

Companies: KOOSDYCLBSIGPIPXMCBCBGSNRSOLICRWAPTDGAMAVANLWATR

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

SRT Marine Systems plans to 'pedal on' with core technology for the maritime industry

Companies: SRT Marine Systems plc

VSA Capital Tech & Transitional Energy 140526

Companies: AVONAVGBABIMIGAMAIESAURR

Senior (SNR) - Vox Markets Fund Manager Series: Q&A with James Thorne, Fund Manager at Columbia Threadneedle

Companies: Senior plc

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top