• 17 Apr 26

VSA Capital Tech & Transitional Energy 170426

VSA Capital Tech & Transitional Energy 170426

Concurrent Technologies Plc, 264 | Avingtrans plc, 660 | ITM Power PLC, 207 | SRT Marine Systems plc, 89.0 | Frontier IP Group Plc, 16.0 | Taiwan Semiconductor Manufacturing Co., Ltd. Sponsored ADR, 0 | Pulsar Helium, Inc., 86.4 | ASML Holding NV, 0 | Equipmake Holdings Plc, 1.2 | Amcomri Group Plc, 142

    • 148 views

 

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

VSA Capital Morning Miner 280526

Companies: WWICERTGSVRPLSR

Vox Markets Video Wrap

Companies: QDEALUVTYCHHTIDEDGEAVGIQESFTITRKANCRITMJET2EXPNDNLMPINEFRASEZJHVOFDEVBBSNRMVGMSBRCKTUNEAUTOBKSPMIDCCSAGACLXRPIVRCIWISE

Dekiln & Johnson Tiles partner to scale green tile technology

Companies: Frontier IP Group Plc

Frontier IP Group, Cordiant Digital, Anglo Asian Mining, Helium One, Light Science Technologies - Small Caps

Companies: Frontier IP Group Plc

Dekiln & Johnson Tiles partner to scale green tile technology

Companies: Frontier IP Group Plc

focus ON Pulsar Helium: An Introduction; Pulsar’s Topaz Discovery Explained

Companies: Pulsar Helium, Inc.

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top