• 30 Jan 25

VSA Capital Tech & Transitional Energy 300125

VSA Capital Tech & Transitional Energy 300125

QUALCOMM, 0 | Microlise Group plc, 43.0 | MICROSOFT, 0 | Eleco Plc, 130 | Chesterfield Special Cylinders Holdings PLC, 44.0 | DotDigital Group PLC, 49.3 | Kromek Group Plc, 9.5 | Ceres Power Holdings plc, 803 | ASML Holding NV, 0 | Tesla, Inc., 40,550

    • 296 views

 

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

Kromek Group PLC to begin rapid production of ventilators from next week

Companies: Kromek Group Plc

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

Kromek, Adriatic Metals, Ocean Wilson - Small Cap Snapshot

Companies: Kromek Group Plc

The Exchange with Gervais Williams of Premier Miton

Companies: TUNACGENSIONDOCNCPGHELCOMEGPZTFPAYEOGSRTBVXPCYANNIOXYU/BKSTBTGCTAMPALLST

Q&A with Eleco CEO Jonathan Hunter and CFO Neil Pritchard

Companies: Eleco Plc

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top