• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×

working
  • 19 Jun 2025

What are you thinking? Juneteenth edition


SAP SE (SAP:ETR), 0 | AMAZON COM (AMZN:NYSE), 0 | Amazon.com, Inc. (AMZN:NAS), 0 | MICROSOFT (MSFT:NYSE), 0 | Microsoft Corporation (MSFT:NAS), 0 | International Business Machines Corporation (IBM:NYS), 0 | Oracle Corporation (ORCL:NYSE), 0 | Oracle Corporation (ORCL:NYS), 0 | ADOBE SYSTEMS (ADBE:NYSE), 0 | Adobe Inc. (ADBE:NAS), 0 | INTUIT (INTU:NYSE), 0 | Intuit Inc. (INTU:NAS), 0 | Accenture (ACN:NYSE), 0 | Accenture Plc Class A (ACN:NYS), 0 | ALPHABET INC-CL A (GOOGL:NYSE), 0 | Alphabet Inc. Class A (GOOGL:NAS), 0 | salesforce.com (CRM:NYSE), 0 | Salesforce, Inc. (CRM:NYS), 0 | Meta Platforms Inc Class A (META:NAS), 0 | ServiceNow (NOW:NYSE), 0 | ServiceNow, Inc. (NOW:NYS), 0 | Workday (WDAY:NYSE), 0 | Workday, Inc. Class A (WDAY:NAS), 0 | Shopify, Inc. Class A (SHOP:NAS), 0 | Zoom Video Communications Inc (ZM:NYSE), 0 | Zoom Communications, Inc. Class A (ZM:NAS), 0 | Snowflake, Inc. (SNOW:NYS), 0

  • BNP Paribas Exane
    • Slowinski Stefan SS

    • 7 pages


 

This content is only available within our institutional offering.

Sign in

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account


Sign In
Not a commercial user? Register here for our wider research bundle

What are you thinking? Juneteenth edition


SAP SE (SAP:ETR), 0 | AMAZON COM (AMZN:NYSE), 0 | Amazon.com, Inc. (AMZN:NAS), 0 | MICROSOFT (MSFT:NYSE), 0 | Microsoft Corporation (MSFT:NAS), 0 | International Business Machines Corporation (IBM:NYS), 0 | Oracle Corporation (ORCL:NYSE), 0 | Oracle Corporation (ORCL:NYS), 0 | ADOBE SYSTEMS (ADBE:NYSE), 0 | Adobe Inc. (ADBE:NAS), 0 | INTUIT (INTU:NYSE), 0 | Intuit Inc. (INTU:NAS), 0 | Accenture (ACN:NYSE), 0 | Accenture Plc Class A (ACN:NYS), 0 | ALPHABET INC-CL A (GOOGL:NYSE), 0 | Alphabet Inc. Class A (GOOGL:NAS), 0 | salesforce.com (CRM:NYSE), 0 | Salesforce, Inc. (CRM:NYS), 0 | Meta Platforms Inc Class A (META:NAS), 0 | ServiceNow (NOW:NYSE), 0 | ServiceNow, Inc. (NOW:NYS), 0 | Workday (WDAY:NYSE), 0 | Workday, Inc. Class A (WDAY:NAS), 0 | Shopify, Inc. Class A (SHOP:NAS), 0 | Zoom Video Communications Inc (ZM:NYSE), 0 | Zoom Communications, Inc. Class A (ZM:NAS), 0 | Snowflake, Inc. (SNOW:NYS), 0

  • Published: 19 Jun 2025
  • Author: Slowinski Stefan SS
  • Pages: 7
  • BNP Paribas Exane


What happened? We spent last week and this week meeting with investors in New York, San Francisco, London and Paris (including our usual US holiday lunch in London). Below, please find feedback on what ''you'' the investor is thinking as summarise views we hear across our US Software Largecap coverage. BNPP Exane View: Accenture - Investors are either not interested in IT services or believe Accenture needs to bring down FY''26 consensus. The only question is: will it be tomorrow, or in September?'' - Sentiment long only: bearish - Sentiment hedge fund: bearish Adobe - We were surprised how many investors have said they have given up on Adobe altogether, with many investors telling us they have even taken Adobe off of their Bloomberg screens! - Sentiment long only: bearish - Sentiment hedge fund: bullish (before results, now likely less so on lack of ARR growth upgrade) Alphabet - Many investors believe the stock is too cheap, Gemini 2.5 is impressive, and the product cadence has improved, BUT are worried about (take your pick) Search Chat GPT disruption, Chrome sale, Apple default loss, Regulatory uncertainty. - Sentiment long only: bearish - Sentiment hedge fund: bullish (on near term revenues and a window where Google may still have strong Search and also start monetising AI search before the competition) Amazon - This was an investor darling last year on margin improvements. While still positive, investors are frustrated that tariff noise has interrupted the margin story, for now. - Sentiment long only: bullish - Sentiment hedge fund: bullish (but not as much as last year) IBM - With the stock ticking higher seemingly every day, without earnings revisions, investors keep asking what is driving the re-rating. - Sentiment long only: bearish - Sentiment hedge fund: bullish Intuit - Investors find Intuit a complicated story. It was nice to see the Turbo Tax Live perf in Q3, but where does the stock go from here. ''What is the story?'' - Sentiment long...

More Content

More Content

LaKeel (4074) - Q2 FY12/25 results update, Upbeat outlook taking shape

Companies: WDAY 4060 9719 4074 4684 4776 3771 3921 4478 4448 4733 4165 SAP

Astris Advisory

THE NAKED FUND MANAGER - China shows Western Tech Giants might be stifling innovation

Companies: RMVJE/0RIH0R1O0QZI

Research Tree

VSA Capital Tech & Transitional Energy 280825

Companies: ORSTEDAVGONVDAMRVLFTCJNEOSNOWAURR

VSA Capital

Most popular equity research this week | 1 - 11 Jan

Companies: SLPUBISMPACNXTALTFDEVALPHCDMGMDGLESPEGFINGTLYBURATVI0IFXKYYWY0QYP0LCX

Research Tree

Management Consulting 18 August 2025

Companies: Accenture (ACN:NYSE)Accenture Plc Class A (ACN:NYS)

Acquisdata
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • Chrome Extension
  • iOS and Android Apps
  • LLM Feed
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2025

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Edge Group
      • The Life Sciences Division
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • Fox-Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • Align Research
      • Allenby Capital
      • AlphaValue
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • Fox-Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Allenby Capital
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • Kepler | Trust Intelligence
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In