• 05 Jul 2018

GMP FirstEnergy ― UK Energy morning research package

Chevron Corporation, 0 | JKX Oil And Gas, 44.5 | Rockhopper Exploration, 33.0 | Sdx Energy, 0

    • FirstEnergy Research Team

    • 2 pages

Stock Image


 
Stock Image


Chevron (CVX US) (not covered): Looking to sell the UK | JKX Oil & Gas (JKX LN) (not covered): Trading update in the Ukraine and Russia | Rockhopper Exploration (RKH LN) (not covered): Operational update in Egypt | SDX Energy (SDX LN)1,6; BUY, £0.80: Appraisal well spudded in Egypt

Sign up to access

Get access to our full offering from over 30 providers

Get access to our full offering from over 30 providers


Get Started
Already a member? Log in here

More Content

More Content

GMP FirstEnergy ― UK Energy morning research package

Companies: RDSA RDSB SEN UKOG SDX TETY

Most popular equity research this week | 16 - 20 July

Companies: HMIAPCAVONCSRTCGSTIDEELMFPOHEADHILSHTGAMSMACFMPACMKLWOXIGPKGSNXSCPARSWRNOSUSSIVTRIVTCZTFFPMDEMGAMOEMRBLVNHDYBGOSHGRKHJHDTRAKDTGLAMPDGLSAICALLHURIOGPCAEUSPCDMPIERHAYDFDMREDDCAKENAHSPERORGTLYECSCGETBFUTRGORINDIIBPORBWABBYKETLJELGENLABCBGEEC

GMP FirstEnergy ― UK Energy morning research package

Companies: ARG TNP JKX VGAS SAVP

Capital Network's Lionel Therond on SDX Energy

Companies: Sdx Energy

Jadestone Energy (JSE LN/CN): BUY, £0.70; Montara Acquisition completion update | Verus acquires assets in the UK | Regal Petroleum (RPT LN) (not covered): 1H18 results | SDX Energy (SDX LN/CN)1,6: BUY, £0.80; Potential acquisition in Egypt | Savannah Petroleum (SAVP LN) (not covered): Seven Energy transaction update in Nigeria | Tower Resources (TRP LN) (not covered): Prospective resources in South Africa

Companies: Jadestone Energy Sdx Energy

Copyright © 2018 Research Tree | All Rights Reserved. | Terms of Service and Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Tools licensed and contents implemented and optimized by Digital Look Ltd.

DigitalLook |Web Financial Group

©1999-2013 – Digital Look Ltd. A Web Financial Group Company All rights reserved. Legal notice.

Top