• 25 Mar 26

2 P's on a Pod: Profit Warnings, Geopolitics & the Hunt for Value

2 P's on a Pod: Profit Warnings, Geopolitics & the Hunt for Value

Goodwin PLC, 14,000 | Volex plc, 676 | Bloomsbury Publishing Plc, 639 | Grainger plc, 153 | Mission Group Public Limited Company, 19.0 | Pinewood Technologies Group PLC, 252 | YouGov plc, 205 | Crest Nicholson Holdings Plc, 71.4 | S4 Capital plc, 44.2 | NIOX Group Plc, 59.8 | Spire Healthcare Group PLC, 222 | Mortgage Advice Bureau (Holdings) plc, 527 | AOTI, Inc., 60.0

    • 74 views

 
In this week’s live smallcap show, UK equity analyst & markets commentator Paul Scott & I discussed our latest thoughts on 17 stock ideas.

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

2 P’s on a Pod: Small Cap Investing with Paul Hill & Paul Scott

Companies: ENSIONDOCARGDWNAMSNWFHIKEXPNSYS1CVSGTRCSRELRSTHVOBRCKSPICCCIHCDOMCERSUPWISE

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

The Exchange with Richard Crow (alias Cockney Rebel).

Companies: VCTSRTMARSSFORCARDBOOMSAGA

The Exchange with Gervais Williams of Premier Miton

Companies: TUNACGENSIONDOCNCPGHELCOMEGPZTFPAYEOGSRTBVXPCYANNIOXYU/BKSTBTGCTAMPALLST

Bloomsbury Publishing hails the success of Sarah J. Maas franchise

Companies: Bloomsbury Publishing Plc

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top