• 30 Jan 24

Vox Markets Fund Manager Series - Q&A with James Thorne, Fund Manager at Columbia Threadneedle

Vox Markets Fund Manager Series - Q&A with James Thorne, Fund Manager at Columbia Threadneedle

Microlise Group plc, 43.0 | 1Spatial Plc, 0 | Crest Nicholson Holdings Plc, 72.6 | Oxford BioMedica plc, 617 | Tekmar Group Plc, 12.9 | Manolete Partners Plc, 38.0 | Gym Group Plc, 0 | Knights Group Holdings Plc, 0 | ActiveOps plc, 0 | Halfords Group Plc, 0 | Reach plc, 0 | Avingtrans plc, 0 | Auction Technology Group PLC, 409 | W.A.G. Payment Solutions Plc, 0

    • 214 views

 

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

Knight Group Holdings plc: FY26 Trading Update - High quality growth justifies a rerating - 20 May 2026

Companies: Knights Group Holdings Plc

Vox Markets Video Wrap

Companies: QDEALUVTYCHHTIDEDGEAVGIQESFTITRKANCRITMJET2EXPNDNLMPINEFRASEZJHVOFDEVBBSNRMVGMSBRCKTUNEAUTOBKSPMIDCCSAGACLXRPIVRCIWISE

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

2 P's on a Pod: Profit Warnings, Geopolitics & the Hunt for Value

Companies: GDWNVLXBMYGRITMGPINEYOUCRSTSFORNIOXSPIMAB1AOTI

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

Avingtrans - Vox Markets Fund Manager Series: Stephen English of Stellar Asset Management

Companies: Avingtrans plc

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top