• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×

working
  • 15 Oct 2024

Software & AI Q3 previews. Software fightback continues


SAP SE (SAP:ETR), 0 | AMAZON COM (AMZN:NYSE), 0 | Amazon.com, Inc. (AMZN:NAS), 0 | MICROSOFT (MSFT:NYSE), 0 | Microsoft Corporation (MSFT:NAS), 0 | International Business Machines Corporation (IBM:NYS), 0 | ALPHABET INC-CL A (GOOGL:NYSE), 0 | Alphabet Inc. Class A (GOOGL:NAS), 0 | Meta Platforms Inc Class A (META:NAS), 0 | ServiceNow (NOW:NYSE), 0 | ServiceNow, Inc. (NOW:NYS), 0

  • BNP Paribas Exane
    • Slowinski Stefan SS

    • 7 pages


 

This content is only available within our institutional offering.

Sign in

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account


Sign In
Not a commercial user? Register here for our wider research bundle

Software & AI Q3 previews. Software fightback continues


SAP SE (SAP:ETR), 0 | AMAZON COM (AMZN:NYSE), 0 | Amazon.com, Inc. (AMZN:NAS), 0 | MICROSOFT (MSFT:NYSE), 0 | Microsoft Corporation (MSFT:NAS), 0 | International Business Machines Corporation (IBM:NYS), 0 | ALPHABET INC-CL A (GOOGL:NYSE), 0 | Alphabet Inc. Class A (GOOGL:NAS), 0 | Meta Platforms Inc Class A (META:NAS), 0 | ServiceNow (NOW:NYSE), 0 | ServiceNow, Inc. (NOW:NYS), 0

  • Published: 15 Oct 2024
  • Author: Slowinski Stefan SS
  • Pages: 7
  • BNP Paribas Exane


What happened? Today we publish the results of our Quarterly EuroVision Software Reseller Channel Check Survey, where we survey 25 resellers (~50% in Europe). We also publish the results of our proprietary quarterly Digital Advertising TRACKER. We also publish earnings previews for September quarter-end Large Cap Software and AI companies we cover, including Alphabet, Amazon, IBM, Meta, Microsoft, SAP and ServiceNOW. BNPP Exane View: Our Software Reseller Survey results were most positive for SAP and IBM (revenge of the legacy continues) They were Neutral for Google Cloud and ServiceNOW (will Neutral be good enough for NOW?) And disappointing for AWS and MSFT. (will this accelerate the continued shift away from mega caps?) Our Digital Ad TRACKER was Neutral for Alphabet and META. (is Neutral good enough for META?) For Alphabet, we also provide the results of our investor survey on what they are looking for from the new CFO (hint: more communication), as well as feedback from last week''s Google Cloud Summit that we attended in London. Software Spending Trends have improved from Q2 lows Last quarter, our survey results reflected the weakness than many Software (and IT Services) companies saw in Q2 with discretionary spend weaker, longer deal cycles, and more macro pressures, especially in Europe. The results of our October Survey indicate trends have returned to where they had essentially been for the past ~15 months (see chart below). From a Software segment basis, Cyber Security enters our Survey in top position. As a reminder, Andrew DeGasperi initiated on four Cyber Security stocks last week. That sector note is here: Mission Critical: Searching for AI Winners. BI, AI / ML, Public Cloud were the next most in demand categories. Workflow Automation, CRM and Data Warehousing all fell one to two steps. While Digital Advertising outperformed Software demand in H1, we see Advertising trends normalising as comps get more challenging, while Software...

More Content

More Content

LaKeel (4074) - Q2 FY12/25 results update, Upbeat outlook taking shape

Companies: WDAY 4060 9719 4074 4684 4776 3771 3921 4478 4448 4733 4165 SAP

Astris Advisory

Most popular equity research this week | 1 - 11 Jan

Companies: SLPUBISMPACNXTALTFDEVALPHCDMGMDGLESPEGFINGTLYBURATVI0IFXKYYWY0QYP0LCX

Research Tree

Cybersecurity 11 August 2025

Companies: GEN FTNT HPQ FEYE HO DELL SPLK CHKP DXC DXC CSCO PANW NOC FTNT LMT INTC BA/ CSCO CHKP INTC LMT GEN HO NOC HPQ DELL IBM 4704 PANW

Acquisdata

Platforms are taking over the world

Companies: JE/G4MTWTR*0QZI0QYI

Research Tree

Online Survey Software 11 August 2025

Companies: SPNS SAPNRA SAP SAP SAPH SAP SAPPE 269A ALMER ALMER SAPN SPAI SAPCL SACL 2501 9776 SPNS SRB SAPU SAP SAPT SFL SAPP SAPP SSLG 452430 SAPPHIRE

Acquisdata
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • Chrome Extension
  • iOS and Android Apps
  • LLM Feed
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2025

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Edge Group
      • The Life Sciences Division
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • Fox-Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • Align Research
      • Allenby Capital
      • AlphaValue
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • Fox-Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Allenby Capital
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • Kepler | Trust Intelligence
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In