• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×

working
  • 17 Mar 2020

Consumer Goods: Reality check


AB INBEV (ABI:EBR), 0 | Anheuser-Busch InBev SA/NV (ABI:BRU), 0 | British American Tobacco p.l.c. (BATS:LON), 4,398 | C&C Group Plc (CCR:LON), 94.0 | Coca-Cola HBC AG (CCH:LON), 4,225 | Diageo plc (DGE:LON), 1,485 | Imperial Brands PLC (IMB:LON), 2,674 | Pernod Ricard (RI:EPA), 0 | Pernod Ricard SA (RI:PAR), 0 | Reckitt Benckiser (Bangladesh) PLC (RECKITTBEN:DHA), 0 | Reckitt Benckiser Group plc (RKT:LON), 4,470 | Tate & Lyle PLC (TATE:LON), 496 | Unilever PLC (ULVR:LON), 4,140

  • Investec Bank
    • Nicola Mallard | Alicia Forry, CFA | Anthony Geard

    • 14 pages


 

This content is only available within our institutional offering.

Sign in

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account

This content is only available to commercial clients. Sign in if you have access or contact support@research-tree.com to set up a commercial account


Sign In
Not a commercial user? Register here for our wider research bundle

Consumer Goods: Reality check


AB INBEV (ABI:EBR), 0 | Anheuser-Busch InBev SA/NV (ABI:BRU), 0 | British American Tobacco p.l.c. (BATS:LON), 4,398 | C&C Group Plc (CCR:LON), 94.0 | Coca-Cola HBC AG (CCH:LON), 4,225 | Diageo plc (DGE:LON), 1,485 | Imperial Brands PLC (IMB:LON), 2,674 | Pernod Ricard (RI:EPA), 0 | Pernod Ricard SA (RI:PAR), 0 | Reckitt Benckiser (Bangladesh) PLC (RECKITTBEN:DHA), 0 | Reckitt Benckiser Group plc (RKT:LON), 4,470 | Tate & Lyle PLC (TATE:LON), 496 | Unilever PLC (ULVR:LON), 4,140

  • Published: 17 Mar 2020
  • Author: Nicola Mallard | Alicia Forry, CFA | Anthony Geard
  • Pages: 14
  • Investec Bank


Upgrades Coca-Cola Hellenic to Buy (from Add), Unilever to Buy (from Add) and Tate & Lyle to Hold (from Sell). Downgrade: Diageo to Sell (from Hold). Estimates could fall significantly for Consumer Goods companies highly exposed to the on-trade, which include Spirits, Brewers and Soft Drinks. Spirits and Brewers derive roughly half of their revenue from the higher margin on-trade, with Soft Drinks slightly less exposed. However, some of these sales will shift to the off-trade as consumers will drink at home – though there will probably be some trading down in this process. Assuming a drastic scenario, we think sales for these companies could fall by 15%; more realistically we think they could fall by 5-10%. We expect the drop in sales and volumes for these products will be temporary, as has been the case in previous crises, and that, longer term, Spirits, Brewers and Soft Drinks offer attractive mid-single digit organic sales growth that should entice investors with longer time horizons. In the more defensive areas, such as Food, HPC and Tobacco, companies may even see a short term boost to growth as households stock up. These companies have outperformed the wider market by 5-20% year-to-date in the UK & Europe. High quality names in the wider Consumer Goods sector have maintained significant valuation premiums. Beiersdorf, L’Oréal, Estee Lauder, Coca-Cola, Pepsi, Colgate, Church & Dwight, P&G, Campari and Remy are still trading on consensus-based CY20 PE’s north of 20x – whereas the average for our coverage is 12.5x. The sell-off in Tobacco is the most surprising to us, given the clearly defensive nature of the product. Governments in Europe have allowed tobacconists to remain open in areas where other shops have closed, in acknowledgment of citizens’ need for access to tobacco and tobacco alternatives. Leverage is a key concern for investors in the current environment, and indeed many Consumer Goods companies are burdened with debt following several years of heavy deal-making. However, even the most levered company, ABI (currently 4.5x net debt/EBITDA), can afford to lose 74% of its cash from operations before it would need to find other sources of cash to make its annual interest payment. ABI has $16bn total liquidity across its revolving credit facility (already fully drawn down) and cash on hand, and has $3bn of debt maturing in 2020. It also is yet to receive the $11bn in proceeds from the sale of its Australian business to Asahi. The second most levered company, BAT (currently 3.5x net debt/EBITDA), would have to lose 84% of its cash from operations before it would not be able to pay its interest out of internally-generated cashflows. These large, multi-national, defensive companies are unlikely to find themselves in a position of needing to raise capital even if coronavirus impacts business significantly. Furthermore, the low interest rate environment should be helpful for re-financing debt across the sector once markets stabilise.

More Content

More Content

British American Tobacco:New Categories accelerating

Companies: British American Tobacco p.l.c.

Edison

Most popular equity research this week | 25 - 29 Sept

Companies: CONNDSCVBOOTRNWHCMSLOKLRMCLLSTAFSXXULVRWYGUTWNAPSSVCAPRSMPURPVANLWATRPPHDEBSFCRMNEXN

Research Tree

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

Vox Markets

Market Report: Biden reveals $1.9tn coronavirus stimulus package

Companies: British American Tobacco p.l.c.

Proactive

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

Vox Markets
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2026

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Allenby Capital
      • Alternative Resource Capital
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • EM Spreads
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • Morphose Capital Partners
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Primary Portal
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS Research Group
      • RBC Capital Markets
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Curious Compounder
      • The Edge Group
      • The Investor Summit
      • The Life Sciences Division
      • ThinkFront
      • Ticker TV
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Venn Brown
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • Fox Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • AlphaValue
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • xxxxxx_deleted
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • Fox Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • Kepler | Trust Intelligence
      • Longspur Clean Energy
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In