• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×
  • 07 Jul 17
title

Most popular equity research this week | 3-7 July

  • 1038 views
Rob Mundy

Helping investors and companies

 
best ideas
Strap line

See what was trending this week...

Companies: 7DIG, AVON, 0RSP, BLTG, PRSM, BBSN, CTH, DQ6, CVSG, E3C, ELM, EUSP, FDM, FA/, GKN, HVN, HRI, HILS, HCM, INF, IQE, SQS, MYSL, NEXN, NOG, OTB, PPIX, QRT, RNUGF, RNOPF, RTHM, RWS, SNR, SERV, SFR, POLY, STJ, SNX, 21W


Body

Best Ideas 2017 - H1 Review

A strong H1, CVS Group and Renold added for H2

By N+1 Singer, 3 July

Gold Access

 

IQE | Renold | SDL | CVS Group | Elementis | Redde | Reneuron Group | Mysale Group | Servelec Group | Herald Investment Trust | Severfield | Rhythmone | Cineworld Group | Hill & Smith

 

"Today we publish our H1 review of our Best Ideas for 2017 – the document in which we also outlined our key top down and bottom up investment themes for the year. Our 12 top picks in January were Cineworld, Elementis, Herald Investment Trust, Hill & Smith, IQE, MySale, Redde, ReNeuron, RhythmOne, SDL, Servelec and Severfield which have collectively outperformed the wider market by 13% YTD. At the half way stage we retire Cineworld and Hill & Smith from the portfolio (both were moved from Buy to Hold in May after outperformance), to be replaced by CVS Group and Renold. We also give a brief update on the rationale for our picks."

 


Conviction List Q3 2017

By Panmure Gordon, 5 July

Gold Access

 

Aldermore | Avon Rubber | CareTech | GKN | Harvey Nash | Hutchison China Meditech | Informa | Nostrum Oil & Gas | On The Beach Group | Polymetal International | Senior | Sqs Software Quality Systems | St. James's Place

 

"Since its inception in 2010, the Panmure Gordon Conviction List has outperformed the market, returning 284% against a Small Companies index that would have returned 221% over the same period. Our Q3 portfolio reflects our belief that the global reflation trade runs into the stark reality of political deadlock in the US and intractable structural frictions in the Eurozone. Despite recent moves higher, low nominal fixed income spreads continue to provide a valuation underpin for global equities. There are increasing signs that Central Bankers are making a concerted effort to move off near zero interest rates. However with global debt exceeding 200% of GDP and unfavorable demographic trends, we think their chances of success are slim."

 

 

Tech Biweekly - Outperforming the market

By Stockdale, 7 July

Gold Access

 

Brave Bison | ECSC | Eu Supply | FDM | ProPhotonix | Quarto | Sprue Aegis | Sqs Software Quality Systems | Synectics

 

"With half the year behind us, we evaluate the performance of the tech sector versus the broader market, and look across the Atlantic to see how the London listed technology universe compares to its larger and better known counterparts. The UK tech sector has outperformed the broader UK market and the Nasdaq and S&P 500 over the past year. Last week saw another successful technology company listing- Ethernity Networks- demonstrating that there continues to be a strong appetite for quality tech companies in London."

 

 

Blancco Technology Group (BLTG)

Strong H2’17 offset by one-off £2.2m charge | Equity Development, 6 July
Free Access

 

"This morning’s pre-close trading statement was a bit of a curate’s egg. On the one hand, FY17 revenues soared 40% YoY (~30% constant currency) - in line with expectations – to an estimated £31.4m from £22.4m LY. The vast majority of this growth being organic, and reflecting buoyant demand for its proprietary data erasure software, augmented by the roll-out of its award-winning smartphone diagnostics product (Xcaliber) across up to 6,000 retail stores in North America."


 

7Digital (7DIG)

A step change with 24-7 deal | Edison, 4 July
Free Access

 

"7digital’s acquisition of 24-7 consolidates its position as the largest provider of B2B music services in Europe and adds £18m of secured revenues to its pipeline. Accelerated platform integration means EBITDA profitability will be pushed out to FY18, when management expects the deal to be significantly earnings enhancing and the group to be both profitable and cash flow positive."

 

 

Taptica International (TAP)

Making a great impression | finnCap 5 July
Gold Access

 

"Taptica offers a global end-to-end mobile advertising platform that helps the world's top brands reach their most valuable users with the widest range of traffic sources available. It utilises AI and machine learning to leverage proprietary big data for quality media targeting in high volumes. Cutting-edge algorithms assesses huge volumes of data in milliseconds, enabling global giants like Amazon, Disney, Facebook and Twitter to serve the right ad impressions, to exactly the right user, at exactly the right time – and at the right price – on mobile or social media channels. More than 600 clients are scaling and engaging more relevantly with mobile audiences, staying ahead of their competition. Headquartered in Israel, it is expanding globally: in the US, China, Korea and now the UK."

 

 

Blue Prism (PRSM)

UiPath Call | Whitman Howard, 3 July
Gold Access

 

"Blue Prism call with No3 player UiPath We had a call with Gary Kirkwood of UiPath. UiPath have recently raised $30m on we believe a $80m pre money valuation, with Accel Partners leading the round. UiPath has recently moved its HQ to the US and is intending to IPO on NASDAQ in 2019/2020"

 

 

On The Beach Group (OTB)

Sanguine over Summer Lull | Panmure Gordon, 5 July
Gold Access

 

"A six month reporting gap leaves scope for macro concerns to fill the news vacuum. June, traditionally the weakest month for travel sector equities, has seen OTB shares level off following a stellar 40% YTD run. We would view any summer share price drift ahead of prelims (30 November) as an opportunity to buy into this structural growth story. We remain sanguine for the following reasons: 1) robust passenger data, 2) post-terrorism normalisation, 3) c70% pre-booked peak trading, and 4) benign H2 marketing comp." 


 


Body Two

Body Three

Body Four

Body Five

The information contained within this post is based on personal experience and opinion and should not be considered as a recommendation to trade nor financial advice.

More Content

More Content

Hybridan Small Cap Feast: 17 December 2025

Companies: ARV GENI NET SNX CCT ENQ N4P VCP ATM RCFX

Hybridan

Most popular equity research this week | 14-18 Nov

Companies: AVONBTRWGNSJET2SVTKRSWJGNG/VLGHZDTILSRTHMKAPECRE0J2R

Research Tree

Industrials Monthly - A turbulent 2025; cautious earnings outlook for 2026 - December 2025

Companies: TAND BMS AVON CGS CKN GHH PEN ASY SCE SOLI TRI SYM IGE JDG AFC AVAP PEG CSSG ABDP WPHO KETL SPSY

Zeus Capital

Most popular equity research this week | 16 - 20 Oct

Companies: WJASEEPLI600258FARNMYE0CSRTAMSMEGPSYMDPHLGTEKFANCRIMMAGYTSTLCTHBOTBDOTDBVXPSCLPABCFULDNLVLGHZDVECSHOECAKESCSIDPTRCFISHJOULBDRXHCMHCHOF0NR1C4JMLM

Research Tree

HUTCHMED: Pipeline potential underpins long-term growth prospects

Companies: HUTCHMED (China) Limited Sponsored ADR

Trinity Delta
next
 
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2025

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Allenby Capital
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • EM Spreads
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • Morphose Capital Partners
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS Research Group
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Curious Compounder
      • The Edge Group
      • The Life Sciences Division
      • ThinkFront
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • Fox-Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • AlphaValue
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • xxxxxx_deleted
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • Fox-Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • Kepler | Trust Intelligence
      • Longspur Clean Energy
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In